Details for Capsella Locus Carubv10016430m

Position : scaf_3 ( 5`- 612141 .. 612458 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016430m

Protein [Map View]
MTGKAKPKKHTAKEIQAKIDAALTNRGGGKAGIADRTGKEKGGHAKYECPHCKITAPDLKTMQIHHESKHPKLTYDESKL
VNLHAVLAPVAESKPKPGIRGSLKK*

DNA
ATGACTGGTAAGGCGAAGCCGAAGAAGCACACGGCGAAGGAGATTCAAGCGAAGATCGATGCTGCGTTGACGAATCGAGG
AGGAGGAAAAGCTGGAATCGCTGACAGGACCGGAAAAGAGAAAGGAGGTCACGCTAAGTACGAGTGTCCTCACTGCAAAA
TTACGGCTCCGGATCTAAAGACTATGCAGATCCATCACGAATCCAAGCATCCTAAGCTCACTTATGATGAATCAAAGCTC
GTGAATCTCCATGCTGTTTTAGCACCAGTTGCTGAGTCAAAACCTAAACCTGGTATCAGGGGAAGCTTGAAGAAGTAA