Details for Capsella Locus Carubv10016426m

Position : scaf_3 ( 5`- 3586399 .. 3588865 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016426m

Protein [Map View]
MNNQDETKVETVSKNSFNDQEQEVKTDNMSDQDKNTKEIKIEAKNKNGLGETWPEPIVRVQSLAESNLSTVPDRYIKPPS
QRPQTTITNHQPEAAALNIPVIDLDSLFLGNEDDMKKISEACREWGFFQVINHGVKPELMDAARETWKSFFNLPVEDKEV
HSNSPRTYEGYGSRLGVEKGAILDWNDYYFLHFRPLPLKDFNKWPSLPSNIREVTDEYGKELVKLGGRLMAILSSNLGLK
EEQLQEAFGGDGVGACMRANYYPKCPQPELALGLSPHSDPGGITILLPDEQVTGLQVRHGDTWITVNPHPNAFIVNIGDQ
VQILSNSKYKSVEHRVTVNSEKERVSLAFFYNPKSDIPIQPMQQLVTSTMPPLYPPMTFDQYRLFIRTQ

DNA
ATGAACAACCAAGACGAGACCAAGGTCGAGACCGTGAGCAAGAACAGCTTCAACGACCAAGAACAAGAAGTCAAAACAGA
CAACATGAGTGACCAAGACAAGAACACGAAGGAGATCAAGATCGAAGCCAAGAACAAGAATGGCCTTGGCGAAACGTGGC
CAGAACCCATCGTCCGAGTCCAGTCCCTAGCCGAGAGCAACCTCAGCACCGTACCCGACCGTTACATCAAGCCGCCATCT
CAACGCCCTCAAACCACCATCACCAACCACCAACCGGAAGCTGCTGCCTTAAATATCCCGGTCATAGACCTAGACAGCCT
CTTCTTAGGCAACGAAGACGACATGAAGAAGATATCGGAGGCATGCCGTGAATGGGGGTTCTTTCAGGTGATCAACCATG
GGGTGAAGCCGGAGTTGATGGACGCAGCTAGAGAAACTTGGAAAAGCTTCTTCAACTTGCCCGTGGAAGACAAAGAAGTT
CACTCAAACTCCCCAAGGACCTATGAAGGATACGGAAGCAGATTGGGTGTAGAGAAAGGAGCCATTCTTGATTGGAATGA
TTATTACTTTCTCCATTTTCGTCCTCTTCCTTTGAAGGATTTCAACAAATGGCCTTCTCTACCTTCCAACATTAGAGAAG
TGACTGATGAGTACGGGAAGGAGCTAGTGAAGCTAGGCGGGAGACTCATGGCGATCTTATCGTCAAACTTGGGGCTGAAA
GAAGAACAGCTTCAAGAAGCATTTGGTGGAGATGGCGTTGGTGCATGTATGAGGGCTAACTATTACCCAAAATGTCCTCA
ACCTGAGCTTGCCCTCGGCCTCTCTCCTCATTCCGATCCCGGCGGCATTACCATCCTCTTGCCGGACGAACAAGTCACCG
GCCTTCAAGTCCGTCACGGTGACACGTGGATCACTGTCAATCCTCACCCCAACGCTTTCATCGTCAATATCGGCGATCAA
GTTCAGATACTAAGCAATTCGAAGTACAAGAGCGTGGAACATCGAGTGACAGTGAATTCGGAAAAAGAAAGGGTTTCACT
AGCGTTCTTCTACAACCCTAAGAGTGACATTCCGATCCAACCAATGCAACAACTTGTCACCTCTACGATGCCTCCTCTGT
ATCCTCCCATGACCTTTGATCAGTACAGACTCTTCATTAGGACGCAA