Details for Capsella Locus Carubv10016419m

Position : scaf_3 ( 5`- 7419772 .. 7426828 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016419m

Protein [Map View]
MESILARALEYTLKYWLKSFTRDQFKLQGRTAQLSNLDINGEAIHASMGLPPALSVTTAKVGKLEIMLPYVSNVQTEPVV
VQIDKLDLVLEENPDADVTKGPSSVQSPTASGKSNGYGFADKIADGMTLQVKVVNLLLETGGGAHREGGAAWAAPLASIT
IRNLVLYTTNESWKVVNLKEARDFSTNTGFIYLFKKLEWEALSIDLLPHPDMFTDANLARSEEANLRDDDGAKRVFFGGE
RFLEGISGQAYITVQRTALNSPLGLEVQLHIPEAVCPALSEPGLRALLRFLTGMYLCLNRGDVDPKSQQSAEAAGRSLVS
VLVDHVFLCIKDAEFQLELLMQSLLFSRACVSDGESANYLTKILIGGLFLRDAFSRSPCALVQPSMKAAAEDLAVPEFAK
NFCPLIYPLDNGPWQIVQDVPLISLHSLQVKPSPKPPHFSSKTVIQCQPLMVHLQEEACLRISSFLADGIVVNPGDVLPD
NSVNSLLFTLRELDVSVPLDMSNFEDSAVKENLSVKNSFVGARLHIENLSFAESPTLKVRLLNLEKDPACFCLWPGQPID
ASQKKWTAGASHFSLALETSPNSTERQSSRGPEMGLWNCVEGKDMSIEVAMVSADGKPLITIPPPGGIVRIGVACEQYIS
RASVEQLFFVLDLYSYFGKVSEKISIVKESKRQNTVSLTGGLLENVPSDTAIKLALKDLQLKFLESSFTSTQDMPLVQFL
GKDLSVKVTHRTLGGAIAVSSNIYWENIEVDCVDTDIQDEHENSWNGHLVSCNGSTPLRRVFWVVNGRHDGQSGSTLTTP
FLDISITHVIPLSEKDMECHSVSIVACISGVRLGGGMSYAEALLHRFGILNHDGGPGEGLSRGLEHLSSGPLSKLFKASI
IDDRKKDGTPGNWNGDGFPHLGRPDDIDVSVELRDWLFALEGREDVGTRILHNEDIGREERCWHTNFRTFRVIAKSTPKN
VDPKGTGNQYNARKYPVDSIIVSVEGLQTVKPQMQKGTDSCNRLPTNGVYENGHVLGGVNVEANIVASDDKSVHDDSLNW
VAESLKFSVKQPVEAVVTKDELQHLTFLCKSEVDAMGRIVAGVLRVLKLEESIGQATLNQLSNLGSEGFDKMFSPKASRA
GSPKISPFAVSSDSMREMSSRTNLESTISSIEEASMELEAKCSVLVSDLSDSESAANHAHELKQKLECLQSLMAKLRTQI
*

DNA
ATGGAGTCGATACTGGCTCGAGCCTTGGAGTATACTCTCAAGTATTGGCTCAAATCATTCACCAGAGATCAGTTCAAGCT
TCAAGGCCGTACCGCTCAGCTTTCTAATCTAGACATTAATGGTGAGGCTATACATGCCAGTATGGGTTTGCCACCCGCAC
TTAGTGTGACTACTGCCAAAGTTGGAAAATTGGAAATCATGCTTCCGTATGTCAGTAATGTACAAACGGAACCTGTAGTT
GTGCAAATCGATAAACTCGATCTTGTTCTTGAAGAAAATCCTGATGCTGATGTGACAAAGGGTCCAAGCAGTGTTCAGTC
TCCTACCGCCTCTGGAAAAAGTAATGGTTATGGATTCGCTGACAAGATTGCAGACGGAATGACTTTACAAGTTAAGGTGG
TCAATCTTCTTCTTGAAACTGGAGGTGGTGCTCACCGCGAAGGAGGGGCAGCCTGGGCTGCTCCGCTGGCATCTATTACA
ATACGTAACCTTGTTCTGTATACCACTAATGAGAGTTGGAAGGTTGTAAATCTGAAAGAAGCAAGGGACTTCTCTACTAA
CACAGGATTTATTTATTTGTTTAAGAAACTTGAATGGGAAGCTTTATCAATTGATCTTCTACCACATCCTGATATGTTCA
CTGATGCTAATTTAGCCCGCTCAGAAGAAGCAAATCTCAGAGATGATGATGGTGCAAAACGAGTTTTCTTTGGTGGAGAA
CGCTTTTTAGAAGGAATTTCTGGCCAAGCATATATTACAGTTCAAAGAACAGCGCTAAACAGTCCACTAGGGCTTGAAGT
TCAGTTGCACATTCCAGAAGCTGTTTGTCCGGCGTTAAGTGAACCAGGGTTGCGCGCTCTTCTCCGCTTTCTAACTGGAA
TGTACTTATGCCTAAACCGCGGAGATGTGGATCCAAAATCTCAGCAGTCTGCTGAAGCAGCAGGACGTTCTCTTGTCTCC
GTTCTTGTGGACCATGTATTTTTGTGCATTAAAGATGCTGAATTTCAACTGGAACTACTCATGCAGTCACTCCTTTTTTC
TCGAGCATGTGTTTCGGATGGAGAATCAGCTAACTATTTAACCAAGATTTTGATTGGTGGGCTATTTTTAAGGGATGCTT
TTTCGCGCTCTCCTTGTGCTCTAGTCCAACCATCTATGAAAGCTGCTGCCGAAGACCTTGCAGTTCCCGAATTTGCCAAG
AATTTTTGTCCTCTTATATATCCATTGGACAATGGCCCGTGGCAAATAGTTCAGGATGTACCCTTGATCTCCCTACATTC
TCTTCAGGTCAAGCCATCCCCAAAACCCCCACACTTTTCCTCAAAGACAGTTATCCAGTGCCAACCACTCATGGTTCATC
TTCAGGAAGAAGCTTGTTTACGAATTTCTTCTTTTCTGGCTGATGGCATTGTTGTGAATCCCGGTGATGTTTTACCCGAT
AACTCTGTTAACTCTCTTCTTTTCACCCTGAGGGAGTTAGATGTCTCTGTTCCATTAGACATGAGTAATTTCGAAGATTC
AGCAGTCAAAGAAAACCTTTCCGTAAAAAACTCCTTCGTTGGGGCGAGGCTTCATATTGAAAACTTATCTTTTGCGGAGT
CACCTACCCTAAAAGTTCGGCTACTAAACCTGGAAAAGGATCCTGCTTGCTTCTGTCTTTGGCCGGGACAGCCTATTGAC
GCCAGCCAAAAGAAATGGACAGCTGGAGCCTCACATTTTAGTTTGGCTTTGGAAACATCTCCCAACTCAACTGAACGTCA
GAGCTCTCGTGGTCCGGAAATGGGTTTGTGGAATTGTGTTGAAGGAAAAGACATGTCTATAGAAGTTGCTATGGTATCTG
CGGATGGAAAGCCACTGATAACAATTCCTCCTCCTGGTGGTATTGTTCGCATAGGAGTTGCTTGTGAGCAATATATTTCG
CGTGCTTCAGTGGAGCAATTATTTTTTGTTCTGGACCTCTATTCTTACTTTGGTAAGGTCAGTGAAAAAATTTCAATTGT
TAAAGAAAGCAAACGCCAGAATACTGTTTCCTTGACTGGAGGGTTGTTGGAGAATGTTCCTAGTGATACTGCTATAAAAT
TGGCTTTGAAGGATCTGCAGCTCAAGTTTCTTGAGTCTTCCTTTACTAGTACTCAGGATATGCCACTCGTTCAGTTTCTT
GGCAAAGATCTTTCTGTGAAGGTAACTCATAGAACCCTTGGTGGCGCTATTGCAGTATCCTCCAACATATACTGGGAAAA
TATTGAGGTAGATTGTGTAGATACTGACATACAAGATGAACATGAGAATAGCTGGAATGGTCACTTAGTTAGCTGTAATG
GGTCTACCCCACTGAGGCGTGTCTTTTGGGTTGTCAACGGAAGACATGATGGGCAAAGTGGCAGCACTCTAACGACACCT
TTTCTAGACATAAGCATAACACATGTGATTCCCCTCAGTGAAAAGGATATGGAGTGCCACAGTGTAAGTATCGTGGCTTG
CATTTCAGGTGTACGCCTAGGGGGAGGAATGAGCTATGCTGAAGCTCTATTACACAGATTCGGAATTCTGAACCATGATG
GTGGTCCAGGAGAGGGTTTATCTAGAGGATTAGAACATTTATCTTCTGGGCCTTTGTCAAAACTTTTCAAAGCATCTATA
ATTGATGACAGGAAAAAGGATGGAACTCCAGGAAACTGGAATGGCGATGGTTTCCCACATTTGGGAAGGCCAGATGACAT
TGATGTCTCTGTTGAGTTAAGAGACTGGTTGTTTGCTTTGGAGGGCAGAGAAGATGTTGGCACACGAATTCTGCATAATG
AAGATATTGGCAGAGAAGAGAGGTGTTGGCACACAAATTTCCGTACATTCCGAGTAATAGCCAAGAGTACACCGAAGAAT
GTGGATCCAAAAGGGACAGGAAATCAGTATAATGCTCGCAAGTATCCTGTGGACTCAATTATTGTCAGTGTCGAAGGTCT
ACAGACAGTGAAGCCTCAAATGCAGAAAGGGACCGATTCTTGTAATCGTTTGCCTACAAATGGAGTTTACGAAAATGGTC
ACGTGCTTGGAGGGGTAAACGTTGAAGCTAACATTGTGGCTTCGGATGACAAATCTGTTCATGATGACTCATTGAACTGG
GTGGCAGAAAGTCTGAAATTCTCTGTTAAGCAACCTGTTGAGGCAGTTGTTACAAAGGATGAGTTGCAACATTTGACATT
CTTGTGCAAATCTGAAGTTGATGCAATGGGAAGGATAGTCGCAGGGGTTTTACGTGTGCTAAAGCTCGAAGAATCTATTG
GCCAGGCGACTCTAAATCAACTAAGCAACCTTGGAAGTGAAGGTTTTGACAAGATGTTCTCTCCAAAAGCGAGCAGAGCA
GGAAGTCCAAAAATCTCACCTTTTGCTGTATCATCAGACTCGATGAGAGAAATGTCGTCACGTACAAACCTAGAATCTAC
CATTTCTTCCATCGAAGAAGCGTCAATGGAGTTAGAGGCCAAGTGTTCAGTTCTGGTTTCTGATCTCAGCGATTCAGAAT
CTGCAGCGAATCACGCCCACGAGCTCAAGCAGAAACTCGAGTGTTTGCAGAGCTTAATGGCTAAATTACGAACCCAAATC
TGA