Details for Capsella Locus Carubv10016418m

Position : scaf_3 ( 5`- 7247256 .. 7250437 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016418m

Protein [Map View]
MNRNEDNVEPTMKDESPFGKLSEDLLIEIFIRVPITNWDQISCVRKQWANLFRGECLWQAALNRTYPLASKTKRWTGPIR
QGLSKRRYVALYISRNILGVDTDIDEMLGHIYLFLKDQLQLSTTPASGILHGTLIDQLIVCGKSKEEADELVTKIWLALL
DNLEDTKHTFIVLKSIAQEYDGFLPYPYLRPIKMQWKVFERLFVDFRDLLDHSEYCDLIGIAKKKFQTLSTFFFEMALTK
VLTILVLCVLVSTSTLTQSSDGGHISILVSKTGLEFAKDFLIKKVISTTIPLQLPGIEKKVRIPLIGKVRMGLSNIQIDA
VDVQSSKVETGKDGIVLSVSGTTADLSMGWSYTYRASFFQISDHGDAFVKVKGIDVKTAVTLLDDNGSLKIATRESDCRV
DNIDIHINGGTSWLYQGVVDAFQKAIISTVESTVSKKVLEKMGKLDSFLQSLPKERKIDDSAAVNLSFTGNPVLGNSSVE
VGINGLFMPKGNDIKVSGSRSSSFFGGVNRMVTISIEEEVFNSATLVYFNGKVMHLVIGETKNGSILSTSDWKLILPELY
KHYPDDKMMLNMSVTSHPAVRISENGIDSTIQLEIGIDVQDSREVLSVARISTVLNVACSVEIAENNLTGSLGLIDFNAT
MKWNKFGELESNDVQAATSRILEALFLPYVNTRLKRGFPLPIPSEFTIKNIEIAYVKSAILVHTNIGTSTSTNH*

DNA
ATGAACCGCAACGAAGATAACGTTGAGCCGACAATGAAAGATGAAAGTCCATTCGGGAAGCTTTCAGAGGATCTCTTGAT
AGAGATATTCATCAGAGTTCCAATTACAAATTGGGATCAAATATCTTGTGTTAGAAAACAGTGGGCGAATTTGTTCCGAG
GAGAATGCTTATGGCAGGCTGCTCTGAACCGGACGTATCCTCTTGCTAGCAAAACTAAGAGATGGACTGGACCAATCCGG
CAAGGATTAAGCAAACGGAGATATGTGGCTTTGTACATCAGCAGGAACATTTTAGGTGTGGATACAGACATAGATGAGAT
GCTTGGACATATTTACTTGTTCTTGAAAGATCAGCTTCAACTTTCCACTACGCCTGCTTCAGGCATCTTGCATGGAACCC
TCATTGATCAATTGATTGTTTGTGGCAAATCCAAAGAAGAAGCTGATGAGCTTGTGACAAAGATCTGGCTTGCTCTTCTC
GACAATTTAGAGGACACGAAACATACATTTATCGTGCTGAAGTCAATCGCACAAGAATATGATGGCTTTCTTCCATATCC
TTACTTAAGACCGATCAAGATGCAGTGGAAGGTGTTTGAGAGACTGTTTGTGGATTTCCGCGACTTGCTTGATCATTCAG
AGTACTGCGACCTTATAGGAATTGCCAAGAAGAAGTTTCAAACATTATCCACTTTCTTCTTCGAAATGGCTCTCACGAAA
GTTTTGACGATTCTCGTTCTCTGTGTTTTGGTATCAACATCAACCTTGACGCAATCCAGCGATGGAGGACACATCTCTAT
ACTCGTCTCAAAAACCGGTCTTGAGTTTGCGAAAGATTTTCTCATTAAGAAAGTGATCTCTACGACGATTCCGCTTCAGC
TACCAGGGATCGAGAAGAAGGTTAGAATCCCTTTGATCGGGAAAGTTCGAATGGGTCTCTCGAATATTCAGATTGATGCA
GTTGATGTCCAGTCTTCGAAGGTCGAAACGGGAAAAGATGGAATCGTTTTGAGTGTTTCAGGTACGACAGCAGATTTGAG
CATGGGATGGTCCTATACTTATAGAGCTTCCTTCTTTCAGATTTCTGATCATGGAGATGCTTTTGTTAAGGTTAAAGGAA
TAGATGTGAAAACCGCTGTCACTCTGCTTGATGATAATGGAAGTCTAAAGATTGCCACACGGGAAAGTGATTGTAGAGTG
GACAACATCGATATTCATATCAACGGTGGTACTTCTTGGCTGTATCAAGGGGTGGTTGATGCATTTCAAAAGGCGATTAT
ATCTACTGTTGAAAGCACCGTCTCTAAGAAAGTTTTGGAGAAGATGGGGAAGCTTGATTCTTTTTTGCAATCACTTCCAA
AAGAGAGGAAGATTGATGACTCTGCGGCCGTCAATCTCAGTTTTACAGGCAACCCTGTCTTAGGAAATTCTTCGGTTGAA
GTTGGAATCAATGGTTTATTCATGCCAAAGGGTAATGATATTAAAGTATCAGGGTCTCGTTCTTCTTCCTTCTTTGGCGG
GGTTAACAGAATGGTCACAATTTCTATAGAAGAAGAAGTTTTCAACTCTGCAACACTTGTCTACTTCAATGGTAAGGTGA
TGCATTTGGTTATTGGTGAAACAAAGAACGGGTCGATTCTAAGCACATCTGACTGGAAACTCATCCTTCCAGAGCTGTAC
AAACATTATCCAGATGATAAAATGATGCTTAATATGTCAGTAACATCTCATCCTGCTGTTAGAATCAGCGAGAATGGAAT
TGATTCGACGATTCAGCTAGAGATAGGAATCGATGTTCAAGACTCTAGAGAAGTCCTGTCTGTGGCACGCATATCAACGG
TTTTGAATGTTGCGTGTTCTGTGGAAATCGCAGAGAACAATCTAACTGGTAGCCTCGGATTAATAGATTTCAATGCAACA
ATGAAGTGGAATAAATTTGGAGAGCTTGAGTCAAACGATGTCCAGGCTGCTACGTCTAGGATTCTTGAAGCCTTGTTTTT
GCCGTACGTAAACACACGCCTCAAGAGAGGATTCCCCTTGCCAATTCCAAGCGAATTCACGATAAAAAACATAGAGATTG
CTTATGTTAAAAGTGCCATTTTAGTCCATACCAATATAGGCACTAGCACAAGCACAAACCACTAG