Details for Capsella Locus Carubv10016402m

Position : scaf_3 ( 5`- 4949371 .. 4949697 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016402m

Protein [Map View]
MIGRRAGTNRVGMKRDDSLLTRFVDSVFYFFRLAEFEILFVLFIIITYVIFKDLTARPEYNRILVEKPGGSDIWPF*

DNA
ATGATCGGCCGGCGTGCTGGAACGAATCGAGTCGGTATGAAGAGAGACGACTCTCTTCTGACCCGGTTTGTTGACTCAGT
ATTCTATTTCTTCCGATTGGCTGAGTTTGAGATCCTCTTTGTGCTCTTCATCATTATAACCTACGTCATCTTCAAAGATC
TGACGGCGAGGCCTGAGTACAATCGGATTCTTGTGGAGAAACCCGGTGGATCTGACATCTGGCCGTTCTAA