Details for Capsella Locus Carubv10016399m

Position : scaf_3 ( 5`- 4472645 .. 4473231 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016399m

Protein [Map View]
MRVLLCKIQCPSFICFCKPSPHIYASGSLKLENTPPQVSPSTTVVHDRDHHDDNVDDAHVDEEAVDHVDVLLSEDREEDC
AALEVKKEEEEGHTNGEILRSSLRKEVLDSADGGRREKKKVQWVDLMGKELAEIREFESSEEEDVRYDGDQSCVCVIL*

DNA
ATGAGGGTTTTGCTGTGTAAGATCCAGTGCCCTTCTTTCATCTGTTTCTGTAAGCCTTCTCCTCATATCTACGCATCTGG
TTCTCTTAAATTGGAGAACACCCCTCCTCAAGTGTCTCCTTCTACTACTGTTGTTCATGATCGTGATCATCATGATGATA
ATGTCGACGATGCACATGTAGACGAAGAGGCTGTTGATCATGTGGATGTTTTGTTGTCTGAGGATAGAGAAGAAGATTGT
GCAGCTCTAGAGGTGAAAAAAGAAGAAGAAGAAGGTCATACTAATGGGGAAATCTTGAGAAGTAGTCTCAGAAAGGAAGT
TTTAGATTCAGCTGATGGTGGGAGAAGGGAGAAGAAGAAGGTACAGTGGGTGGATTTGATGGGGAAAGAACTTGCTGAGA
TCCGAGAATTTGAGTCTAGTGAAGAAGAAGATGTCAGATATGATGGCGATCAAAGCTGTGTTTGTGTTATTCTGTGA