Details for Capsella Locus Carubv10016398m

Position : scaf_3 ( 5`- 1103271 .. 1103825 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016398m

Protein [Map View]
MKKVEDYADRMITFSKRKGGIFKKMNEFVAMCNVEVAILVFSQAGKAYTFAYPSMDEVAARLKNPWGQELVVKDDTVPLV
EAYKKRRIQDHMIKMEALDEELAQDLEKLKLLKKSRKEKKVGKMWWNIPQEGLSMKEAQRRHRALVELHDNLREMFISLS
GNGGASSSSAGSWGCDHSSGDESG*

DNA
ATGAAGAAGGTTGAAGACTATGCTGATAGGATGATTACGTTCTCAAAACGTAAAGGCGGGATTTTCAAGAAAATGAACGA
GTTCGTAGCTATGTGCAACGTCGAAGTGGCTATCTTGGTTTTCTCTCAAGCCGGAAAGGCGTATACGTTCGCATATCCGT
CCATGGATGAAGTGGCAGCCAGGTTGAAGAACCCTTGGGGACAAGAACTTGTTGTGAAAGACGATACGGTACCGCTCGTC
GAAGCTTATAAGAAACGAAGGATCCAGGACCACATGATCAAAATGGAGGCACTCGACGAGGAGCTTGCGCAAGATCTAGA
GAAGCTGAAACTGCTAAAGAAATCAAGAAAGGAAAAGAAGGTGGGCAAAATGTGGTGGAACATTCCTCAGGAAGGCTTGA
GCATGAAGGAGGCACAGCGAAGGCACCGAGCACTTGTTGAGTTACATGATAACTTACGTGAAATGTTTATTTCACTGTCG
GGAAACGGGGGTGCTAGTTCATCTTCTGCTGGTAGTTGGGGATGTGACCACTCTAGTGGTGACGAATCTGGTTAA