Details for Capsella Locus Carubv10016394m

Position : scaf_3 ( 5`- 6457349 .. 6458641 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016394m

Protein [Map View]
MGNTSSMLTQYDIEEVQSHCDDLFEQQEILSLYQRFCQLDRNAKGFISADEFLSVPEFAMNPLSQRLLKMVDGLNFKDFV
AFLSAFSAKASLRQKVQLIFKVYDSDCNGKVSFKDIMEVLRDLSGSFMSDEQREEVLSQVLKESGYTSDSFLTLEDFIKI
FGSCRPEMDVEIPVD*

DNA
ATGGGAAACACTTCGTCGATGCTGACTCAATACGACATCGAAGAAGTCCAGAGCCATTGTGATGATCTATTTGAACAGCA
GGAGATTCTATCTCTGTATCAAAGGTTTTGCCAGTTAGATCGTAATGCAAAGGGATTTATTTCTGCTGATGAGTTTCTCT
CTGTGCCTGAATTTGCAATGAATCCACTATCTCAGAGGCTGCTTAAGATGGTTGATGGTTTGAACTTTAAGGATTTTGTG
GCTTTCCTGTCTGCATTTAGTGCCAAGGCAAGTCTACGACAAAAAGTTCAACTGATCTTTAAAGTCTATGATTCGGACTG
CAACGGGAAGGTCTCCTTTAAAGATATCATGGAAGTGTTGCGGGACTTATCGGGATCATTCATGTCTGATGAGCAAAGAG
AGGAAGTACTGAGCCAGGTTTTGAAGGAATCAGGATACACAAGTGACTCTTTCTTAACACTGGAGGATTTCATAAAGATC
TTTGGGAGTTGCAGACCGGAGATGGACGTCGAAATTCCTGTGGACTAG