Details for Capsella Locus Carubv10016392m

Position : scaf_3 ( 5`- 4712921 .. 4713956 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016392m

Protein [Map View]
MEDHQNEESLSEWFAKYLNRQSDWLEKTRGNLMVTATVIAGMSFQVMVNPPGSVWQGDNCSFGNQTGGSVCKGKAGTAVL
EYESTKRRAYIGMVISSTVSFSASMSLILLVISGLRLRNRMIMAILVTFMVAAVLCISASFLFAVFLVQSDDKLIRDILT
IYVGFWVVFPVLILLVQLVRLIHWLICYLCCCCRQRRRRSPRRLLPLAPSPAP*

DNA
ATGGAAGATCATCAAAACGAAGAATCATTATCAGAGTGGTTTGCAAAGTACTTAAACCGCCAAAGTGATTGGCTAGAGAA
AACAAGAGGGAATCTGATGGTGACGGCTACCGTTATAGCTGGTATGAGTTTTCAGGTTATGGTTAATCCTCCCGGTAGCG
TGTGGCAAGGTGACAACTGTTCTTTCGGAAATCAAACCGGGGGTTCGGTTTGTAAAGGGAAGGCCGGGACTGCTGTGTTG
GAGTACGAGAGTACCAAACGTCGAGCCTATATTGGGATGGTTATTAGCAGTACAGTCTCCTTTTCTGCCTCCATGAGTCT
CATTCTCCTCGTCATCAGCGGTTTACGACTAAGGAACCGGATGATAATGGCGATCCTCGTAACGTTTATGGTGGCGGCGG
TTCTTTGTATATCGGCCTCCTTCTTATTTGCGGTCTTTCTGGTTCAATCCGACGATAAATTGATTCGTGATATACTAACG
ATTTATGTGGGATTTTGGGTCGTGTTTCCTGTTTTAATACTCCTAGTCCAACTTGTTCGATTGATACATTGGCTTATTTG
TTATTTGTGTTGTTGTTGTCGCCAACGTCGACGACGATCCCCTCGACGATTGTTGCCACTGGCTCCATCTCCGGCCCCTT
AA