Details for Capsella Locus Carubv10016390m

Position : scaf_3 ( 5`- 7727020 .. 7727343 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016390m

Protein [Map View]
MKAGSSTFTILLYVLAISLVLSPILPCQATSLPLGGGGRKLMAPSPPILMCPQCECCAPAPPGFCCPCRCPDGP*

DNA
ATGAAAGCTGGGTCATCAACATTCACCATACTCCTATACGTTCTTGCTATCTCGCTGGTCTTGTCTCCAATACTTCCATG
TCAAGCAACTAGTTTGCCTCTAGGAGGTGGAGGGCGTAAGTTGATGGCACCGTCACCACCAATTCTCATGTGTCCACAGT
GTGAATGTTGTGCACCTGCTCCACCCGGTTTTTGCTGCCCATGTCGTTGTCCAGACGGTCCCTAA