Details for Capsella Locus Carubv10016389m

Position : scaf_3 ( 5`- 5585753 .. 5588157 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016389m

Protein [Map View]
MIRLRTYAGLSFMATLAVIYHAFNSRCQFYPAMVYLSTSKISLVLLLNMCLVLMLSLWHLVKFVFLGSLREAEVERLNEQ
AWRELMEILFAITIFRQDFSSGFLPLVVTLLLIKALHWLAQKRVEYIETTPSVSKLSHFRIVSFMGFLLLVDSLFMYSSI
RHLVQTHQASVSLFFSFEYMILATTTVAIFVKYVFYVTDMIMDGQWEKKPVYTFYLELIRDLLHLSMYICFFFVIFMNYG
VPLHLLRELYETFRNFQIRVSDYLRYRKITSNMNDRFPDATPEELTASDATCIICREEMTNAKKLICGHLFHVHCLRSWL
ERQQTCPTCRALVVPPENATSAAAGQRGLHQGSQQGTSSSGNQGSATSSSVGVSNDNLSRHHARLQAAASAASMYGKSIV
YPSAKTVAWSPGIPGTEQVSTEPHQTRPSSYSPSPFPQHSLPSENPQAYANMSETKLEEMRKSLESHLEILRNRLHFLEK
RKPESTESTSEPDNKGKSVADAAE*

DNA
ATGATTCGACTAAGAACATACGCAGGCCTCAGTTTCATGGCGACTTTGGCTGTAATATATCATGCTTTCAACAGTAGATG
CCAATTTTACCCTGCCATGGTTTATTTATCAACATCAAAGATCAGTTTGGTGCTGCTTCTCAATATGTGTTTGGTTCTTA
TGCTCAGTCTCTGGCATTTGGTCAAGTTTGTCTTCTTGGGATCCCTTAGGGAAGCAGAAGTCGAGAGGCTGAATGAGCAA
GCTTGGAGAGAGCTCATGGAGATTCTCTTTGCCATTACTATCTTTCGACAGGACTTCTCTAGTGGGTTTCTTCCTTTGGT
TGTTACTCTTCTGTTGATCAAGGCTCTGCATTGGCTTGCCCAGAAAAGAGTTGAATACATTGAGACCACTCCTTCTGTTT
CTAAGCTGTCTCATTTTCGTATTGTCTCTTTTATGGGTTTCCTTCTTCTTGTGGATAGTCTCTTTATGTACAGTTCTATA
CGCCACTTGGTTCAGACGCATCAGGCTTCGGTTTCTCTCTTCTTCTCATTCGAGTATATGATCCTGGCGACAACAACTGT
TGCTATTTTTGTGAAGTATGTTTTCTATGTGACTGATATGATCATGGATGGTCAGTGGGAGAAAAAACCTGTTTATACTT
TCTATCTGGAGCTTATCCGTGACCTGCTTCACCTGTCCATGTATATATGCTTCTTCTTTGTCATATTCATGAACTATGGT
GTACCTTTGCACTTGTTGCGGGAGCTCTACGAAACCTTCAGGAACTTCCAAATTCGTGTTTCTGATTACCTTCGTTATCG
TAAAATCACATCCAATATGAACGACAGGTTTCCTGATGCAACTCCTGAAGAACTTACTGCAAGTGATGCTACCTGTATCA
TATGCCGTGAAGAGATGACAAATGCAAAAAAACTAATATGTGGGCATCTCTTTCATGTGCATTGTCTTCGATCATGGTTG
GAGCGACAGCAAACATGTCCTACTTGCAGAGCACTTGTTGTGCCTCCTGAGAATGCCACATCTGCAGCCGCAGGCCAACG
CGGATTACACCAAGGTTCCCAACAGGGTACATCAAGCTCAGGTAACCAGGGGTCTGCAACAAGTTCTTCTGTTGGCGTTT
CCAATGATAATTTGAGTAGGCACCACGCCAGGCTTCAAGCAGCTGCTTCTGCAGCCTCCATGTACGGGAAATCAATTGTC
TACCCATCTGCAAAAACAGTAGCTTGGTCGCCGGGTATTCCTGGAACAGAGCAAGTGTCAACTGAACCACATCAAACTCG
TCCTTCATCCTATTCCCCGTCTCCATTTCCTCAGCACAGCCTTCCTAGTGAAAACCCTCAAGCCTATGCAAATATGTCAG
AGACTAAGCTGGAAGAAATGAGAAAATCTCTTGAGAGCCACCTCGAGATTTTGCGAAACCGACTTCATTTTCTGGAGAAG
AGGAAACCGGAATCCACCGAGTCCACAAGCGAACCAGATAACAAAGGAAAATCGGTTGCGGATGCAGCGGAGTAA