Details for Capsella Locus Carubv10016385m

Position : scaf_3 ( 5`- 9455500 .. 9456659 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016385m

Protein [Map View]
MDYMRIFSVLAVALWIMRGVDSRVFGGRGIEKYVTFGQNYVVTWGQSHVSTLHSGQEVDLYMDQSSGGGFESKDSYGSGL
FQIRIKVPGGNTGGIVTAFYLTSKGGGHDEIDFEFLGNNYGKPVTLQTNLFLNGEGNREERFNLWFNPTKHYHTYGILWN
PYQIVFYVDNIPIRVYKNERGLSYPSKPMQVEASLWNGDAWATDGGRTKVNWSYSPFIAHFQDFSLSGCNIDGRSNNVGA
CESSNYWWNTGEYQRLNGHEQQMYEHFRSKYMNYDYCTDRSKYQTPPRECYYH*

DNA
ATGGACTATATGAGAATCTTTAGTGTTTTGGCTGTAGCATTATGGATCATGAGAGGGGTTGATTCTAGGGTTTTCGGAGG
ACGAGGGATCGAAAAATATGTTACTTTCGGCCAGAACTATGTTGTTACGTGGGGACAAAGTCATGTTTCCACACTCCACT
CTGGCCAAGAAGTTGATCTCTACATGGATCAATCTTCAGGTGGTGGGTTTGAATCCAAGGACAGCTACGGATCAGGTCTC
TTCCAAATAAGAATCAAAGTCCCCGGAGGAAACACTGGCGGCATCGTCACCGCTTTTTACTTGACATCGAAAGGAGGTGG
TCACGACGAGATTGACTTCGAGTTTCTTGGGAACAACTACGGTAAACCCGTAACGTTACAGACAAATCTGTTTCTGAATG
GAGAAGGAAACAGAGAAGAAAGGTTTAATCTTTGGTTCAATCCAACTAAACACTACCACACTTATGGGATTCTTTGGAAC
CCTTACCAAATTGTGTTTTACGTGGACAACATCCCAATAAGAGTATACAAAAACGAAAGAGGCTTAAGCTATCCATCAAA
GCCTATGCAAGTCGAGGCTAGTCTATGGAACGGTGACGCTTGGGCCACTGATGGAGGTCGGACTAAGGTTAACTGGTCAT
ACTCTCCTTTCATTGCCCATTTCCAAGACTTCTCTCTATCAGGCTGTAACATAGATGGTCGGAGTAATAACGTCGGAGCT
TGTGAATCCTCTAACTACTGGTGGAATACAGGCGAGTATCAAAGATTAAACGGACATGAACAACAGATGTATGAGCATTT
CAGGAGCAAGTACATGAACTATGACTATTGTACTGATCGTTCTAAGTACCAAACTCCTCCTAGAGAATGTTATTACCACT
GA