Details for Capsella Locus Carubv10016376m

Position : scaf_3 ( 5`- 1803199 .. 1803516 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016376m

Protein [Map View]
MSRNGVSWQSNSGYYGYGYGGGGYVEKRQLFLKSYQFSRKQSLAEKIKRSVKRVVKKVVWIRLKSARKLKRVVWSRLKTA
FFYRRRRFFRLIHPNKHSSSSYCFY*

DNA
ATGAGCAGAAACGGCGTTTCTTGGCAGAGCAACAGCGGTTACTACGGGTATGGGTATGGAGGAGGAGGATACGTGGAGAA
GAGACAACTGTTCCTAAAGAGCTACCAATTCTCGAGGAAACAGAGCTTAGCTGAGAAGATTAAAAGATCCGTCAAGAGAG
TTGTCAAGAAAGTTGTTTGGATAAGGTTGAAGTCTGCTAGGAAGCTGAAACGCGTCGTCTGGTCGCGTCTCAAAACGGCG
TTTTTCTACCGCCGCAGACGCTTCTTTCGTCTCATTCATCCAAACAAACACTCCTCATCATCTTACTGCTTCTACTAA