Details for Capsella Locus Carubv10016375m

Position : scaf_3 ( 5`- 7416144 .. 7417167 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016375m

Protein [Map View]
MASSTLFKLNTQTFKALNPSSHSLCPPKSRIFHLHFSKSLSQQQHSKLNHKSTTTRFFAPLCFSLPSPSSPPISKEEAIL
QLASPKLKKLKQPRFRLEIPILDDDSPSSLSQLAFSIFHDLPISRRGSPNVKLLFLWPDPSSLDSAVKAFRSDSINHIAM
SPVSDAVIKALRSADVAVFMAPERTQLEDVKTASEAFSSKPVVMINPRWLFEEEKSFGDELNGFIGSFEVIYAFTGLEVR
GLLSKRKGVIFKCVRDGVVSGERWNVLVEEEEGNGTLKVVSQFKARPSMEEVELVLYNLMAMNSPITKSAKFLKDLVSNI
TGKK*

DNA
ATGGCTTCCTCGACTCTCTTCAAACTCAATACACAGACATTCAAAGCTCTGAACCCATCTTCCCATTCGTTATGTCCTCC
AAAATCCAGAATTTTCCATCTTCATTTCTCTAAATCACTCTCACAGCAACAACATTCAAAGCTCAACCACAAATCCACAA
CTACTCGTTTCTTCGCTCCTCTCTGTTTCTCTCTTCCTTCACCTTCTTCTCCTCCCATTTCAAAAGAAGAAGCCATTCTT
CAACTCGCTTCCCCTAAACTCAAGAAGCTCAAACAACCAAGATTCCGTCTTGAAATCCCAATCCTTGACGATGATTCTCC
TTCCTCTCTCTCTCAGCTCGCTTTTTCGATCTTCCATGACTTACCCATCTCGAGAAGAGGCTCCCCCAATGTCAAGCTTC
TCTTCCTCTGGCCTGACCCTTCTTCCCTCGATTCCGCCGTTAAAGCTTTCCGGTCTGACTCTATCAACCACATTGCCATG
TCTCCGGTTTCAGACGCTGTCATCAAAGCTCTGAGATCAGCTGACGTGGCGGTTTTCATGGCGCCTGAGAGAACGCAGCT
GGAAGATGTGAAGACGGCGAGTGAAGCTTTTTCTTCTAAACCTGTGGTGATGATCAATCCGAGATGGTTGTTCGAGGAAG
AGAAAAGCTTTGGCGATGAACTCAATGGCTTTATTGGTTCCTTTGAAGTGATATATGCGTTCACAGGTTTAGAAGTGAGA
GGACTGTTGAGTAAGAGAAAAGGAGTGATCTTTAAGTGTGTGAGAGATGGTGTTGTGAGTGGAGAGAGATGGAACGTTCT
TGTTGAAGAAGAGGAAGGCAATGGAACTTTGAAAGTGGTCTCACAGTTCAAAGCTAGGCCATCAATGGAAGAAGTTGAAC
TTGTTCTGTATAATCTGATGGCTATGAATTCGCCTATCACCAAATCAGCTAAGTTTCTCAAAGATTTGGTTTCAAACATC
ACTGGGAAAAAGTAA