Details for Capsella Locus Carubv10016372m

Position : scaf_3 ( 5`- 4192936 .. 4193475 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016372m

Protein [Map View]
MNKKLALLARLLLLTTLVTRISVITRADEELMMQECHNSDNPTLCLRCLSSDPSSPEAEKVGLARIILKCINSHLLTLTK
SASTLGSMHYRNPMAASALKQCGLGFSTAKRGVREADAHLIAGDYDKSAYDVSVKVVDPPVSCKTSLETLNIQVPSSFRY
HMEVYLALTQSLLRIIDRF*

DNA
ATGAACAAGAAGCTGGCTTTGCTTGCAAGACTTCTTCTCCTCACCACACTTGTAACAAGAATATCAGTAATCACCAGAGC
CGATGAAGAGCTAATGATGCAAGAATGCCATAACTCTGACAACCCCACTTTGTGTCTTCGCTGTCTAAGCTCCGACCCCT
CTTCTCCTGAAGCCGAAAAAGTTGGACTGGCTCGAATCATCCTCAAATGTATCAACTCTCACCTCCTTACCCTTACCAAG
AGCGCTTCCACTTTGGGCTCCATGCACTACCGGAATCCCATGGCTGCATCAGCGTTGAAGCAGTGCGGTTTGGGTTTCTC
CACGGCTAAGCGTGGCGTGCGAGAAGCCGACGCTCACTTGATAGCCGGAGACTACGACAAGTCTGCGTATGATGTCAGCG
TGAAGGTGGTGGATCCTCCGGTCTCGTGCAAAACCAGTCTCGAGACACTCAACATCCAAGTGCCCTCAAGTTTTCGTTAC
CATATGGAGGTTTACTTGGCGTTGACTCAATCTCTCCTCAGGATCATTGATCGCTTCTAG