Details for Capsella Locus Carubv10016371m

Position : scaf_3 ( 5`- 6986788 .. 6987069 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016371m

Protein [Map View]
MEGLIPYLIHAIKKDHNRDHQMYRSMSVGSSRSYRPLMMGQEGSSSAQGSSHRRTRSEYNPPVIMDMFDQRSSGFGQKIV
DKDSSFPNIATKT*

DNA
ATGGAGGGGCTAATTCCATATCTGATTCATGCTATCAAGAAAGACCATAACCGTGATCATCAGATGTATCGATCGATGTC
TGTTGGATCGAGCCGAAGCTATCGACCATTAATGATGGGACAAGAAGGTTCTTCTTCAGCACAGGGTTCTTCTCACCGTC
GAACTAGATCGGAGTACAACCCACCTGTTATAATGGATATGTTTGATCAGAGATCATCAGGTTTTGGTCAAAAAATTGTG
GATAAAGATTCTTCTTTTCCAAATATAGCAACAAAGACTTAG