Details for Capsella Locus Carubv10016361m

Position : scaf_3 ( 5`- 13480689 .. 13481412 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016361m

Protein [Map View]
MDMKKQIMDESEKLYCKKSFMLPPPPPPLPPSPGYGSRKIDGDSITNKQIKKFWRQKQIIEEDHLFSAIKAAARVRARNL
SAEDYKRFEESLLDMEDPETEDNQGLKDWWTKSKYAYLNQPALGSADSLKRKRFSTYTPNCFSFKPCNPLYATSLNVF*

DNA
ATGGATATGAAGAAACAGATTATGGATGAGTCTGAGAAGTTGTATTGTAAGAAGTCATTTATGCTGCCTCCTCCTCCTCC
ACCGCTTCCTCCATCTCCGGGATATGGATCAAGAAAGATCGATGGAGACAGCATAACCAATAAACAGATCAAGAAGTTTT
GGAGGCAGAAGCAGATCATTGAAGAGGATCATCTCTTTTCTGCTATTAAGGCTGCAGCTCGTGTCAGAGCTCGTAATCTC
TCTGCTGAGGATTACAAACGCTTTGAAGAAAGTTTGTTGGACATGGAGGACCCGGAAACCGAAGATAATCAGGGATTAAA
AGACTGGTGGACGAAGAGCAAATATGCATACTTGAACCAGCCAGCTCTGGGATCTGCAGATTCACTGAAGAGAAAGAGGT
TTTCGACGTACACACCAAACTGTTTCTCTTTCAAGCCTTGCAATCCTCTCTACGCAACTTCGCTCAATGTCTTTTGA