Details for Capsella Locus Carubv10016360m

Position : scaf_3 ( 5`- 6413891 .. 6414721 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016360m

Protein [Map View]
MICTESNHQRISFAGDLGQSNKGPLMEQPSGPVRRDTTLLDSSNSDFEFHTSRNFDPGDSSPADEIFADGMILPVLPFHV
TTASATPKRLYKYELPPIVSAPSLSSSYLPPPPLPLPEYLRKYSVKETRGSVNGRVSGVNSGLEAEKSSKSFWSFKRSSS
LNCDIKKSLICSFPRLTRSNSTGSVTNSKRGMLRDINKYSSQRHGVPRPGANSSTHMPPPSPPPLCCSSYHLRPQKQARK
NGGGRGGSFWIAPVIGGPSPFGLGSILRLSKEKRNK*

DNA
ATGATCTGCACGGAGTCAAACCACCAGCGGATCTCGTTTGCTGGTGATCTTGGCCAGTCCAATAAAGGACCTCTTATGGA
ACAACCATCAGGCCCGGTTCGAAGAGACACTACTCTTTTAGATTCATCAAACTCAGATTTCGAGTTCCACACATCAAGAA
ACTTTGATCCTGGAGATTCCTCACCAGCCGACGAGATCTTTGCGGATGGCATGATCCTCCCAGTCCTTCCTTTCCACGTA
ACCACTGCATCCGCCACGCCAAAACGTCTCTACAAATATGAGCTCCCTCCTATCGTCTCTGCTCCTTCTTTATCCTCCTC
CTATCTTCCTCCTCCGCCTTTACCATTGCCTGAATACTTGAGAAAATACAGCGTGAAAGAAACTCGGGGAAGCGTAAATG
GTCGAGTGAGCGGTGTAAATTCGGGTCTGGAGGCAGAGAAATCATCAAAGTCATTTTGGAGCTTCAAGAGAAGCTCAAGC
CTGAACTGCGATATAAAGAAGAGTCTGATATGTTCGTTTCCTCGTTTAACGAGAAGCAACTCCACAGGATCAGTAACGAA
TTCGAAGAGGGGAATGCTTAGGGACATTAACAAGTATAGCTCGCAGAGACATGGAGTCCCACGTCCAGGTGCAAATTCGT
CAACTCATATGCCTCCTCCTTCTCCTCCACCTCTCTGCTGCAGCTCGTATCATTTGAGGCCACAAAAACAAGCCAGAAAG
AATGGCGGCGGAAGGGGAGGAAGTTTTTGGATTGCTCCGGTGATCGGTGGTCCATCTCCGTTCGGGTTAGGATCCATCTT
ACGACTTTCAAAAGAGAAGAGAAACAAGTAA