Details for Capsella Locus Carubv10016355m

Position : scaf_3 ( 5`- 4568365 .. 4569240 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016355m

Protein [Map View]
MAYSRVLGRFSSRLKPLCQNLSNKNANVSSLPSPIKSASPSSPTCRLSRSSRLPVELSSMIPLHSAIASSRLVSSLSIES
KIWGLVPQGISMPL*

DNA
ATGGCGTATTCAAGAGTGTTAGGCAGATTCTCGTCTCGGTTAAAGCCTCTATGCCAAAACCTCAGCAACAAGAATGCTAA
TGTTTCATCACTCCCTTCTCCCATCAAATCTGCTTCACCTTCCTCACCAACTTGTCGTCTCAGTCGATCTTCAAGATTAC
CAGTGGAGTTGAGTTCGATGATACCTCTACACAGTGCTATAGCATCGTCCAGGCTTGTCTCAAGTTTGTCCATTGAATCC
AAAATCTGGGGATTAGTTCCTCAAGGTATTTCGATGCCTTTATGA