Details for Capsella Locus Carubv10016351m

Position : scaf_3 ( 5`- 4866400 .. 4867488 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016351m

Protein [Map View]
MNDGSSSSSSSSPNMDSDVLVDETYFSALFDYDEVFPISDENYATELHLQEALFSSLVASTVGVNHHPQVQINLFTQVKQ
EPDIKQEPEIDHHPQLHMNVITQVKQEPAEIKMEPFEPSRMLCNICMDEKPSSDIFRGTTNCTHSYCTDCTVRYVATKIK
ENAARIKCPDVECTSLIEPYACRDLIPKDVFDRWEKILCESLISSWEKFYCPFKDCSGMMVNDGGGDANVTQTECPSCHR
LFCVQCKVAWHAGIGCEEFQRFGNAKKKSSDEEDALLIQMAKNKQWRRCPRCKYYVDKVDGCLHINCRCGFQFCYGCGCE
WVSSHACPIRT*

DNA
ATGAATGATGGTTCGTCGTCATCATCATCGTCAAGCCCAAATATGGACTCTGATGTTCTGGTAGACGAAACCTACTTCTC
CGCTTTATTCGATTACGATGAGGTTTTCCCAATCTCCGACGAGAACTACGCTACGGAGCTCCATCTCCAAGAAGCTCTGT
TTTCTTCCTTGGTCGCTTCTACTGTTGGTGTTAATCATCATCCCCAAGTCCAAATTAATCTTTTCACTCAGGTTAAGCAG
GAACCGGATATCAAGCAGGAACCAGAGATTGATCATCATCCCCAACTCCATATGAATGTTATCACGCAGGTCAAGCAGGA
ACCAGCTGAGATTAAGATGGAACCTTTCGAACCATCAAGAATGCTCTGTAATATCTGTATGGACGAAAAACCTTCCTCTG
ACATCTTCCGAGGAACCACCAACTGCACTCACTCCTACTGCACCGACTGCACCGTACGTTACGTGGCGACTAAGATCAAA
GAAAACGCAGCGAGGATCAAATGCCCTGACGTGGAGTGCACGAGCCTGATAGAGCCGTACGCTTGTCGAGATCTGATCCC
TAAGGACGTGTTCGATCGCTGGGAGAAAATCTTGTGCGAGTCGCTAATCTCCTCATGGGAAAAGTTCTACTGTCCGTTCA
AAGACTGCTCGGGGATGATGGTGAACGATGGAGGTGGAGATGCTAACGTGACGCAGACGGAGTGTCCGTCTTGTCACAGA
CTGTTCTGCGTGCAGTGTAAGGTTGCATGGCATGCGGGGATTGGCTGCGAGGAGTTCCAGAGGTTTGGGAATGCGAAGAA
GAAGAGTAGTGATGAAGAAGATGCTTTGTTGATTCAGATGGCGAAGAATAAGCAGTGGAGAAGGTGTCCTAGGTGCAAGT
ACTACGTTGATAAGGTCGATGGTTGTCTTCATATAAACTGCAGGTGTGGGTTTCAGTTTTGCTATGGATGTGGATGTGAG
TGGGTTTCTTCTCACGCTTGCCCTATTCGCACCTAA