Details for Capsella Locus Carubv10016347m

Position : scaf_3 ( 5`- 2865285 .. 2868571 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016347m

Protein [Map View]
MEGVRVLLACALLLFAVSSIASAAIVEHTFNVQNLTVSRLCKRQVVTVVNGSLPGPTIRVKEGDSLVIHVLNNSPHNITI
HWHGIFHRLTVWADGPSMITQCPIQPGHRYAYRFNITGQEGTLWWHAHSSFLRATVYGALVIRPKSGHSYPFPKPHKEVP
ILFGEWWNTDVVALEETAIATGVPPNNSDAYTINGLPGNLYPCSKDRMFSLNVVKGKRYLLRIINAAMNIQMFFKIANHR
LTVVAADAVYTEPYVTDVITIAPGQTVDALLFADQSIDTSYYMAAHPYASAPGVPFPNTTTRGIIHYAGASKTRRTKRVL
MPKLPAFFDTLTAHRFYSNLTSLVDGPHWVPVPRHVDEEMLVTIGLGLEACADNTTCPKFSASMSNHSFVLPKKLSILEA
VFHGVDGIFTPDFPDQPPVKFDYTNPNITQTNPGLLFTQKTTSAKVLKFNTTVELVLQNHALIAAENHPMHLHGFNFHVL
AQGFGNYDAKRDRSKFNLVNPQFRNTLAVPVGGWAVTRFTANNPGAWIMHCHIDVHLPFGLGMIFVVENGPTKATSLPPP
PLDLPKC*

DNA
ATGGAGGGTGTTAGGGTTTTGCTTGCTTGCGCTCTACTTCTCTTCGCAGTCTCTTCAATAGCTTCTGCCGCCATTGTCGA
ACACACCTTCAACGTACAAAACTTAACGGTGTCTCGGCTGTGCAAACGGCAAGTGGTGACGGTGGTAAACGGAAGCCTGC
CAGGACCAACAATACGCGTGAAGGAGGGTGACTCGCTCGTTATTCACGTCCTCAACAATTCACCTCACAACATCACAATT
CATTGGCACGGGATCTTCCATAGACTAACAGTTTGGGCAGATGGACCGAGTATGATAACGCAATGCCCAATCCAGCCTGG
GCATAGATACGCTTACAGATTCAACATCACCGGCCAAGAAGGTACCTTGTGGTGGCACGCACACTCTTCTTTCCTACGTG
CCACCGTGTACGGTGCTCTTGTCATCCGCCCTAAATCCGGCCACTCTTACCCGTTTCCCAAGCCTCACAAAGAGGTTCCC
ATCTTATTCGGTGAATGGTGGAACACCGATGTAGTCGCATTAGAGGAGACCGCAATCGCCACCGGAGTTCCTCCAAACAA
TTCCGACGCTTATACGATCAATGGCCTTCCCGGAAACCTATATCCATGCTCCAAAGACAGAATGTTTAGTCTAAACGTGG
TGAAAGGAAAGAGATACTTACTACGCATCATAAACGCGGCAATGAACATTCAAATGTTTTTCAAGATAGCCAATCACAGG
CTTACAGTTGTCGCCGCTGACGCAGTCTACACTGAACCTTACGTCACCGACGTCATCACAATCGCACCGGGTCAAACCGT
TGACGCCCTCCTCTTCGCCGATCAGTCCATCGACACCTCCTACTACATGGCAGCTCATCCTTACGCCAGCGCACCCGGCG
TCCCTTTCCCCAACACCACCACCAGAGGCATCATCCACTACGCCGGCGCTTCGAAAACACGGCGAACGAAGCGCGTGTTG
ATGCCTAAGCTCCCTGCCTTCTTCGACACGTTAACCGCTCACAGATTCTACTCCAACCTAACTTCATTAGTCGATGGACC
TCACTGGGTACCAGTACCACGCCACGTGGACGAAGAGATGCTCGTAACCATCGGCCTCGGGCTAGAGGCATGCGCAGATA
ACACCACGTGCCCGAAATTCTCAGCTTCTATGAGCAACCACTCTTTCGTGCTACCTAAAAAGCTGTCGATCTTGGAAGCT
GTGTTCCACGGCGTCGACGGGATTTTCACACCGGATTTTCCAGACCAGCCTCCGGTTAAGTTCGATTACACTAACCCGAA
CATAACCCAAACAAACCCGGGACTTTTGTTCACTCAAAAGACAACGAGCGCCAAGGTTTTGAAATTCAATACGACGGTGG
AGTTGGTGCTGCAGAACCATGCGCTTATCGCAGCTGAGAATCATCCCATGCACCTCCACGGATTCAATTTTCATGTTTTG
GCTCAAGGGTTTGGTAATTATGACGCGAAGCGTGACCGGAGCAAGTTCAATCTCGTTAACCCGCAATTCCGTAACACTTT
GGCTGTGCCTGTTGGTGGATGGGCCGTGACCCGTTTCACTGCTAACAATCCAGGTGCGTGGATTATGCATTGCCATATCG
ATGTTCACTTGCCGTTCGGACTAGGGATGATATTTGTGGTTGAGAACGGGCCGACCAAGGCCACTTCATTGCCACCCCCA
CCACTTGATCTTCCCAAATGTTAA