Details for Capsella Locus Carubv10016346m

Position : scaf_3 ( 5`- 6516850 .. 6517350 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016346m

Protein [Map View]
MAERFSSGEAQYWPIYGTTTTSTVSNGPIASLVHQLRSHSPTSSQLFGFLALFISSGILLLLLGVSVTAALLGFIVFLPL
IILSSPIWIPVFVLVGGFLTVSGFLVGTVAVVSWTYRYFRGMHPVGSNQMDYARSRIYDTASHVKDYAREYGGYFHGRAK
DAAPGA*

DNA
ATGGCGGAAAGGTTCTCTAGCGGCGAGGCTCAATATTGGCCCATCTACGGTACCACTACCACCTCCACCGTTAGCAACGG
CCCCATCGCTTCTCTTGTCCATCAGCTCCGATCTCATTCACCAACCTCTTCACAGCTCTTTGGTTTCCTCGCTCTCTTCA
TTTCCAGCGGAATCCTCCTCTTGCTCCTCGGCGTAAGCGTCACCGCAGCCTTGCTCGGTTTCATAGTGTTTCTTCCATTG
ATCATCTTATCGAGTCCCATCTGGATTCCCGTTTTTGTCCTTGTTGGCGGGTTCTTAACGGTATCAGGATTTCTTGTTGG
AACGGTGGCGGTCGTCTCGTGGACGTACCGCTATTTCCGAGGAATGCACCCGGTTGGCTCGAATCAGATGGATTATGCAC
GTAGTCGGATCTATGACACGGCCTCTCACGTCAAAGATTACGCTAGAGAATACGGTGGTTACTTCCATGGCAGGGCTAAA
GATGCGGCCCCTGGTGCTTGA