Details for Capsella Locus Carubv10016345m

Position : scaf_3 ( 5`- 7585875 .. 7586399 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016345m

Protein [Map View]
MLDLLQPENVLNHHYLGKSSSCCSSFDRVSSSELSPTTRGVNRAERGGEQSIAKANKKAVAAVTVADGVFVKWCDKLELN
RDLTNVVVSYASLALPVEMRPRPRATNRVVLASAFWFGVKNTMTWQSLKKVEDVTGVAAGMIRAVESKMARAMTLQLRRW
RVDSEEGWAENDNV*

DNA
ATGCTCGATTTGCTTCAGCCTGAAAATGTCCTGAATCACCATTACCTGGGGAAATCTTCTTCTTGCTGCTCTTCTTTCGA
TCGTGTCTCGAGCTCCGAGCTGTCGCCGACGACGCGTGGCGTAAACAGAGCAGAGCGAGGAGGGGAACAGAGCATAGCGA
AGGCTAATAAGAAGGCAGTTGCTGCTGTTACGGTCGCGGATGGCGTTTTTGTGAAGTGGTGCGATAAATTAGAACTAAAC
AGAGATTTAACAAACGTCGTCGTTTCGTATGCGTCTCTCGCTTTGCCTGTGGAGATGAGGCCGAGACCGAGAGCGACGAA
CAGAGTGGTCTTAGCGTCGGCGTTTTGGTTCGGCGTCAAGAACACGATGACGTGGCAGAGTTTGAAGAAAGTGGAAGATG
TGACCGGGGTTGCAGCTGGGATGATTCGAGCGGTTGAAAGCAAAATGGCGCGTGCGATGACGCTACAGCTTAGACGGTGG
CGCGTGGATTCGGAGGAAGGATGGGCTGAAAACGACAACGTTTGA