Details for Capsella Locus Carubv10016341m

Position : scaf_3 ( 5`- 8084032 .. 8084370 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016341m

Protein [Map View]
MEGISHIALPVLGIVAVSVVTFYAVSFAEIREKSFKDVYDSENKDGAGFKNSLSSRERRSRREANKKRPKS*

DNA
ATGGAAGGGATAAGCCATATTGCACTCCCTGTTCTGGGAATTGTGGCAGTCTCCGTCGTAACCTTCTATGCCGTTAGCTT
TGCCGAGATCAGAGAGAAATCGTTTAAAGATGTGTATGACTCAGAGAACAAAGACGGAGCAGGGTTCAAGAATTCTTTAA
GTTCGAGGGAGCGAAGATCAAGAAGAGAAGCAAATAAAAAACGTCCTAAATCTTGA