Details for Capsella Locus Carubv10016315m

Position : scaf_3 ( 5`- 3534641 .. 3536162 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016315m

Protein [Map View]
MLLKASPALSLLSSSSGGGGGNLFPLPSRNSSNLLFTSRGSTFSVKAAKGTNTKSLTGVVFEPFEEVKKEMDLVPTTPLV
SLARHKFADDSEAAINDQINVEYNVSYIYHALYAYFDRDNVGLKGFAKFFNDSSLEERGHAEMFMEYQNKRGGRVKLQSI
LMPISEFDHEEKGDALYAMELALSLEKLTNEKLLKLQSVGVKNNDVQLVDFVESEFLGEQVEAIKKISEYVAQLRRMGKG
HGVWHFDQMLLHEV*

DNA
ATGTTGCTCAAGGCCTCTCCCGCTCTCTCTCTATTGAGCTCGAGCTCCGGCGGTGGTGGAGGAAATCTGTTTCCTCTTCC
GTCGAGAAATTCGTCGAATCTTCTGTTTACTTCTCGTGGATCTACGTTTTCTGTTAAGGCGGCGAAAGGCACGAACACGA
AGTCGTTAACCGGAGTTGTGTTTGAACCTTTTGAGGAAGTGAAAAAGGAAATGGATCTTGTTCCCACTACCCCTCTTGTT
TCTCTCGCACGCCACAAGTTTGCCGATGATTCTGAAGCTGCGATCAACGATCAGATCAACGTGGAGTACAACGTTTCCTA
TATCTACCATGCCCTGTATGCCTACTTCGACAGAGATAATGTCGGCTTGAAAGGTTTCGCCAAGTTCTTTAACGATTCGA
GTCTTGAAGAGCGAGGTCATGCTGAGATGTTTATGGAGTATCAGAACAAACGTGGTGGGAGAGTGAAGCTGCAGTCTATT
TTGATGCCCATCTCTGAGTTTGATCACGAGGAGAAGGGGGATGCATTGTATGCGATGGAGCTTGCACTGTCTTTGGAAAA
ACTTACTAATGAAAAGCTTCTGAAGTTACAAAGTGTTGGTGTGAAGAACAATGACGTTCAGCTGGTTGATTTTGTAGAAT
CTGAGTTTCTAGGCGAGCAGGTAGAAGCCATCAAGAAAATCTCAGAGTACGTTGCACAGCTAAGAAGAATGGGAAAGGGT
CACGGAGTGTGGCATTTTGATCAAATGCTTCTCCATGAGGTTTAA