Details for Capsella Locus Carubv10016312m

Position : scaf_3 ( 5`- 8485929 .. 8486507 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016312m

Protein [Map View]
MNNRGKQIDSGSGSGSGSGDNRRTYDCNICKRGFTNPQALGGHNNIHRRERERYFSSSSSSSSNSFPFSLPLPSHQSPSI
NFTNPNISNNSSPYSPTIDESYHHLWSQPPSSHNMTQYFGSSSSSSSSSRGGGGRFAHQGESHGLSLSLGLGYMNHNDDE
THQSPPETGGSQPQDDDLDLDLDLRLGRHRHH*

DNA
ATGAACAACCGGGGAAAACAGATTGATTCCGGCTCTGGCTCTGGCTCCGGCTCTGGAGATAACCGTCGGACTTACGACTG
CAACATCTGCAAGAGAGGTTTCACGAACCCTCAAGCCCTTGGTGGTCACAATAACATCCACCGCAGGGAACGCGAAAGAT
ACTTCTCCTCCTCTTCTTCTTCTTCTTCCAACTCATTTCCATTTTCTCTTCCTTTACCGTCTCATCAGTCTCCCTCCATA
AACTTCACAAACCCTAATATTAGCAACAACTCGTCTCCTTATTCTCCCACCATTGATGAGTCATACCACCACCTATGGTC
TCAGCCACCGTCTAGCCACAACATGACACAATACTTTGGATCATCATCATCATCATCATCATCATCAAGAGGAGGAGGAG
GGAGATTTGCTCATCAAGGGGAGTCTCATGGTCTCAGTTTGAGCTTAGGGCTCGGATACATGAATCACAACGATGATGAA
ACTCACCAAAGCCCACCAGAGACCGGAGGTTCTCAGCCTCAAGATGATGATCTTGATCTTGATCTTGATCTTCGACTCGG
CCGTCATCGTCATCACTAA