Details for Capsella Locus Carubv10016311m

Position : scaf_3 ( 5`- 7361073 .. 7361297 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016311m

Protein [Map View]
MEDSALSNCVRRTIFSNIQQRTIQEAGIEESSWTMYFETQDGLGHNDDSSMMSDAASPMGSVEEDTASSPSNRTK

DNA
ATGGAAGACTCAGCACTAAGCAACTGCGTGAGGCGAACAATATTCTCTAATATCCAACAGAGAACAATACAAGAGGCCGG
TATAGAAGAGAGTAGTTGGACAATGTACTTTGAAACCCAAGATGGATTAGGCCATAACGATGATTCGTCTATGATGTCGG
ATGCTGCCTCTCCTATGGGATCTGTCGAAGAAGACACGGCTTCATCTCCTTCTAACAGAACCAAG