Details for Capsella Locus Carubv10016306m

Position : scaf_3 ( 5`- 8512475 .. 8512885 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016306m

Protein [Map View]
MKNSYILLVVIVVVFISSSGEAKECYGRWICSREDKCKEECMDLYKGVGTCRMYSFPSIPTPVLSYMCDCNFDC*

DNA
ATGAAGAACTCTTATATTCTACTCGTAGTTATTGTTGTTGTCTTCATTTCTTCTTCAGGAGAAGCAAAAGAGTGTTATGG
TCGATGGATTTGTTCTCGTGAAGACAAATGCAAAGAAGAGTGCATGGATTTATACAAAGGAGTTGGGACCTGTCGTATGT
ATTCTTTTCCTTCTATCCCTACTCCGGTTCTTTCTTATATGTGTGATTGCAACTTTGATTGCTAA