Details for Capsella Locus Carubv10016305m

Position : scaf_3 ( 5`- 9507680 .. 9507907 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016305m

Protein [Map View]
MKTYMIILLVILSILIAGRVEANERKKKYLNPGVINRCLRPNPPPECHQNKHIPRTPANKYRRGCTKINRCRRDP*

DNA
ATGAAGACATATATGATAATCTTGTTGGTGATTTTAAGCATCTTGATTGCAGGAAGAGTTGAGGCTAACGAACGTAAGAA
GAAATATCTTAATCCAGGTGTAATCAACCGATGCTTACGTCCTAATCCTCCACCAGAATGTCATCAAAATAAACATATAC
CTCGTACCCCGGCTAACAAATACAGACGTGGTTGCACCAAGATCAACCGATGTCGCCGAGACCCATAA