Details for Capsella Locus Carubv10016293m

Position : scaf_3 ( 5`- 6469642 .. 6470895 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016293m

Protein [Map View]
MASESSAAKMLSFFYGVTGNRIVHPTHGRLSHYYPSCHMMDYVVHSMNITLCDNFDFKQANPYYHPYILRLYCGVLFWIQ
CLRAGNNVNALTDVQYRFLNRFLNNHPLETLAIPGPLLELFKTLCSSQPEFPHNGKVYPQIPAQPGPARRDAFMGNLLES
YFLPNVPGIFALLEDLNRLFSQYPPVYPKRGRHIPVTEDAVSTFGHKTFGSHANRTEAEKWSLVSPGLQYPCEADQKLNE
AFAECYNDFDFQVTAATDNLESISSFLHLKHRMTWFTQVKGVADDVAASFEGSGTLADCPPHGLVANQVMVCLSKPKNLP
DPPTCIADKRATYEFSYKLKSTAFNLSPLTEAVAAFSQTHVRMFPNHPFFGTFGSKTLDHGPFWNRRPIGSSLTDDSSNL
TIPSIVKQAFKSKVPAT*

DNA
ATGGCCTCTGAATCTTCTGCTGCCAAGATGCTTAGTTTCTTTTATGGTGTCACTGGAAACCGAATCGTGCACCCAACCCA
CGGTAGGCTTTCACACTACTATCCCTCCTGCCACATGATGGACTACGTAGTCCATTCTATGAACATTACGCTTTGTGATA
ATTTTGATTTCAAACAAGCCAATCCCTACTATCACCCCTACATCCTCCGCCTCTACTGTGGTGTTCTGTTTTGGATCCAG
TGTCTTAGAGCTGGAAACAATGTCAATGCTCTTACTGATGTTCAATACCGGTTCCTCAACCGGTTCTTGAACAACCATCC
CTTGGAAACTCTCGCCATTCCCGGCCCTCTCCTCGAGCTCTTCAAAACTCTCTGCTCTTCCCAGCCTGAGTTTCCTCATA
ATGGGAAAGTATACCCTCAGATACCTGCTCAACCAGGCCCAGCTCGACGCGATGCCTTCATGGGAAATCTCCTTGAAAGC
TACTTCTTGCCTAACGTCCCTGGGATTTTCGCGCTCTTGGAAGACCTCAACCGTCTATTTTCACAATATCCTCCTGTCTA
TCCAAAAAGAGGCAGACACATTCCTGTAACGGAAGATGCTGTCTCTACCTTCGGTCACAAGACCTTTGGTTCCCATGCTA
ACAGGACCGAGGCTGAAAAATGGTCACTCGTTTCTCCTGGCTTACAGTACCCTTGTGAAGCCGATCAAAAGCTGAATGAG
GCGTTTGCTGAATGCTACAATGATTTTGACTTTCAGGTTACTGCTGCCACTGATAACCTTGAAAGCATCTCCTCCTTCCT
CCACTTGAAACATCGCATGACTTGGTTCACCCAGGTAAAAGGAGTTGCGGATGATGTTGCTGCATCCTTTGAAGGATCCG
GCACCCTTGCTGACTGCCCTCCGCATGGCTTGGTTGCTAACCAAGTCATGGTCTGTCTCTCTAAGCCAAAAAATCTTCCC
GACCCACCAACTTGCATTGCTGATAAGCGTGCAACCTATGAGTTCAGCTACAAGCTCAAAAGCACAGCTTTCAACCTCTC
TCCTCTTACGGAAGCTGTTGCTGCCTTCTCTCAGACGCATGTCAGGATGTTTCCTAACCATCCCTTCTTTGGGACGTTCG
GATCTAAAACTCTTGATCATGGTCCGTTCTGGAACAGGAGGCCCATTGGCTCTAGCCTTACCGATGATAGCTCCAACCTC
ACCATCCCATCGATTGTCAAGCAAGCATTCAAATCCAAAGTCCCAGCTACGTAG