Details for Capsella Locus Carubv10016292m

Position : scaf_3 ( 5`- 1033127 .. 1035049 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016292m

Protein [Map View]
MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDNARGPMKGGIRYHPEVEPDEV
NALAQLMTWKTAVAKIPYGGAKGGIGCDPSELSISELERLTRVFTQKIHDLIGIHTDVPAPDMGTGPQTMAWMLDEYSKF
HGHSPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGMSISGQRFAIQGFGNVGSWAAKLISEKGGKIVAVSDVTG
AIKNKNGIDILGLLEHVEENRGIKGFDGADSIDTDSILVEDCDILVPAALGGVINRENANEIKAKFIIEGANHPTDPEAD
EILRRKGVVILPDIYANSGGVTVSYFEWVQNIQGFMWDEEKVNKELKTYMTRGFKDLKEMCATHSCDLRMGAFTLGINRV
AQATIIRGWGS*

DNA
ATGAATGCTTTAGCAGCAACCAACAGAAACTTCAAGCTAGCTTCTAGACTTCTTGGTTTAGACTCTAAGCTCGAGAAAAG
TCTTCTCATTCCCTTCAGAGAGATCAAGGTGGAGTGTACCATACCTAAAGACGATGGAACTCTTGTATCATATGTTGGAT
TCAGAGTTCAACACGACAATGCAAGAGGTCCCATGAAAGGTGGAATCAGATATCATCCTGAGGTCGAACCGGATGAAGTA
AACGCTTTGGCTCAACTCATGACATGGAAAACAGCAGTGGCTAAGATACCTTACGGAGGAGCCAAAGGAGGAATAGGCTG
TGACCCGAGCGAGCTAAGCATCTCAGAGCTCGAACGTTTGACTCGTGTTTTCACTCAGAAGATCCACGATCTCATAGGCA
TTCATACCGATGTTCCAGCTCCTGATATGGGAACCGGTCCTCAGACAATGGCTTGGATGCTTGATGAATACTCAAAATTT
CACGGACACTCGCCTGCTGTTGTGACCGGAAAACCCATTGATCTTGGTGGATCTCTTGGGAGAGATGCTGCGACAGGAAG
AGGAGTATTATTTGCGACAGAAGCTTTGCTCAATGAACATGGAATGAGCATATCTGGACAGCGATTCGCCATCCAGGGTT
TTGGAAATGTTGGTTCTTGGGCGGCGAAGTTGATAAGTGAAAAAGGTGGTAAGATTGTGGCGGTGAGCGATGTCACAGGA
GCAATCAAGAACAAGAACGGAATCGATATTTTGGGTTTGCTTGAGCATGTCGAAGAAAACAGAGGAATCAAAGGGTTTGA
TGGTGCTGATTCGATTGATACTGATTCTATTCTTGTCGAAGATTGTGATATTCTTGTCCCTGCAGCTCTAGGCGGTGTCA
TCAACAGGGAAAATGCAAACGAAATCAAAGCGAAATTTATCATTGAAGGTGCTAATCACCCAACTGACCCTGAGGCTGAC
GAGATCTTGAGGAGGAAAGGTGTTGTAATCCTCCCAGATATATACGCTAACTCAGGAGGAGTCACTGTAAGTTACTTCGA
GTGGGTTCAGAATATACAAGGATTCATGTGGGATGAAGAAAAGGTGAACAAAGAGCTTAAGACATACATGACTCGAGGAT
TCAAAGACTTGAAAGAGATGTGTGCGACTCACTCATGTGATCTCCGTATGGGAGCTTTCACCCTTGGTATCAACCGTGTC
GCTCAAGCTACCATTATCAGAGGCTGGGGTTCTTGA