Details for Capsella Locus Carubv10016289m

Position : scaf_3 ( 5`- 4174674 .. 4176010 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016289m

Protein [Map View]
MGKKRAPCCDKSQVRRGPWSDEESERLRAFIEKNGHHNWRSLPKLAGLMRCGKSCRLRWINYLRPGLKRGNFTKEEEDTI
IHLHQAHGNKWSKIASHFPGRTDNEIKNVWNTHLKKRLMKSNSLSSSSDATNQSLSSTSSSSSSISSVLKDVIRSSEKPN
QEEEFEEILVEQIACGFEVNAPQSLECLFEDSHIPPPTSKPDLLEINGKSDNEFWSRLLVEPGFDDYNEWLNFLDNQTL*

DNA
ATGGGGAAGAAAAGAGCACCATGCTGTGACAAGAGCCAAGTGAGGAGAGGGCCATGGAGTGATGAAGAAAGCGAAAGACT
CAGAGCTTTTATCGAAAAAAATGGTCATCACAATTGGAGATCTCTTCCCAAACTCGCTGGATTGATGAGATGCGGAAAGA
GTTGTCGCCTAAGATGGATAAACTATCTGAGACCAGGCCTCAAACGAGGCAACTTCACCAAAGAAGAGGAAGATACCATT
ATCCACCTTCACCAAGCTCATGGAAACAAGTGGTCTAAGATCGCATCCCACTTTCCGGGAAGAACAGACAATGAGATCAA
GAACGTGTGGAACACTCATCTCAAGAAGCGATTGATGAAGAGCAACTCATTATCATCATCATCAGATGCTACTAATCAGT
CATTGTCCTCAACGTCTTCTTCCTCTTCCTCGATCTCATCAGTCTTGAAAGACGTTATTAGAAGCAGTGAGAAGCCAAAC
CAGGAAGAGGAGTTTGAGGAAATCTTGGTGGAGCAAATTGCATGTGGATTTGAGGTGAATGCACCACAATCACTAGAATG
TCTCTTTGAAGATAGCCACATTCCTCCTCCTACATCTAAACCAGACTTGCTAGAGATCAATGGGAAATCAGATAACGAGT
TTTGGAGCCGACTACTGGTTGAACCAGGGTTTGATGATTACAATGAGTGGCTCAATTTTTTGGATAACCAAACTTTGTAG