Details for Capsella Locus Carubv10016286m

Position : scaf_3 ( 5`- 626272 .. 627399 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016286m

Protein [Map View]
MVLPWRSRGGVAKRRNQLTTGDISVVETKIPVQLRSSSRKERIKSPRVQLSPRDAVEISQRLENAAARDEYAECYEIVTK
IKNLGGDVNRKCLVQNGGVVALSSCFERFAAVRERHERLLEEILFVLSSWLPLSRSEGFSKMGSTASLNCLVWFLNNATT
DAKTRQNAAFCIREVIAVDKKYVHALTGIEGACDGLVKIIKDSVSTSSTKASLMVIYRTISCNDKIAAIFVKLGLVELIT
EMMVNNAEKSVCERSLVVLNAICDNELCKEDVLTNALIVPLLVKKILRVSDLATQCSVSILWKLWKNNNGDRLLVEAFQV
GAFEKLLVLLQVGCEEKTKERASELLRNLNHCRNEIEKTNCVDSSMHLKNVKKSF*

DNA
ATGGTGTTACCTTGGAGATCAAGAGGAGGAGTAGCAAAGAGACGTAATCAATTGACTACCGGCGATATCTCCGTCGTAGA
AACCAAGATTCCGGTTCAACTCCGATCATCATCGAGGAAGGAGCGGATCAAGTCACCGCGCGTGCAGTTGTCACCACGCG
ATGCGGTAGAGATAAGTCAGAGGTTAGAAAACGCGGCGGCGCGTGATGAATATGCCGAGTGTTACGAGATTGTTACCAAA
ATCAAGAACTTGGGAGGAGACGTGAACAGGAAGTGTTTGGTCCAAAACGGCGGCGTTGTCGCATTGTCTTCTTGTTTCGA
AAGGTTCGCTGCGGTGCGTGAGAGACACGAGCGTCTATTGGAGGAGATCTTGTTTGTTCTGTCTTCCTGGTTGCCTTTGA
GTCGGTCAGAAGGTTTCTCCAAGATGGGATCAACGGCTTCGCTTAACTGTCTCGTATGGTTCTTGAACAACGCTACTACA
GACGCTAAGACGAGACAAAACGCTGCGTTCTGCATCAGAGAGGTTATTGCAGTAGACAAGAAGTATGTGCATGCGTTAAC
AGGTATCGAAGGCGCTTGCGATGGATTAGTTAAGATCATCAAAGACTCTGTTTCGACGAGCTCCACGAAAGCATCTCTAA
TGGTGATTTACAGAACGATATCGTGTAACGACAAGATCGCGGCGATATTCGTGAAATTGGGATTGGTTGAATTGATCACA
GAGATGATGGTGAACAATGCCGAAAAGAGCGTTTGCGAGAGATCTCTAGTTGTTCTAAACGCTATATGCGATAACGAGCT
ATGCAAAGAAGATGTTCTTACAAACGCTTTGATCGTTCCTCTTCTAGTGAAGAAGATTCTAAGAGTTTCGGATCTCGCGA
CACAATGTTCGGTCTCGATTCTTTGGAAGCTATGGAAGAATAATAATGGAGATCGTTTGTTAGTCGAAGCTTTTCAAGTT
GGTGCCTTTGAGAAACTTTTAGTACTATTACAAGTTGGTTGCGAGGAGAAGACGAAGGAGAGAGCGAGCGAGCTCTTGCG
GAATCTAAACCATTGTAGAAACGAGATCGAGAAGACGAATTGTGTCGATTCTTCGATGCATTTGAAGAATGTGAAGAAAT
CTTTTTAA