Details for Capsella Locus Carubv10016284m

Position : scaf_3 ( 5`- 1462586 .. 1464691 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016284m

Protein [Map View]
NSETPILEQLKGDKIIMEPDNSQPFRTDTPEKDPAPAQTDHQSGKRVSAYDLMVVEGDLEGSDPKNEEIHEMLDQIEEKA
SSVLEFSLRWEEIDEQFDLLKQRAMEVDLKEESLRKQVLELDKREERVKLVEERERGRAELIEKEAQSLEANVVGLVLQM
QNEEMVGSQLNSREKLLGLLQDSMMKKHEGLIAELEAREKEVALLSKSIDEKSFDFEMKVKDFDLKQTAETERRRKEAEL
MEASLRELEAREYALRLLNDTIREKSAALEKKEENFQLKQEEVASAIDVKRKSLELKEKELEEREKEIELKQIEDEELSM
QALTRKRSRLESGLSLVATKGRDAEAHTQHNHNNEDKGNNSVSVDSASKSSPVLISEAYEEVVSSENSDEEHEPLLCADS
EFNDFGKTMRSFMAGQVWALYDSIDSMPRLYGRIKKITNRGSSLHLTWFESKDEKSVPSGCGRFKLGITETISDLTFSHV
MHPIIHGRNFIAVIPRRGETWALFRDWSKSWNNNPKQHKPSYKYDFVEVLVNFDDCLGVGVAYLGKVEGFVSVYEKAGQH
GVVSLMIAPEEMQRFSHRVPSFRLNGEEREGVPAGSFELDPAAIISVPLKPDRSIREEAEETARQSEDCGKTCEVDDQDG
LRKDFPIILD*

DNA
AACTCCGAAACTCCAATCTTGGAGCAACTAAAAGGAGACAAAATCATCATGGAACCTGACAATTCACAACCTTTCAGAAC
AGACACGCCGGAGAAGGATCCGGCGCCGGCACAAACTGATCATCAATCTGGAAAAAGGGTTTCTGCATACGATCTTATGG
TAGTGGAGGGTGATTTAGAGGGATCTGATCCAAAAAATGAGGAGATACATGAAATGTTAGACCAGATTGAGGAGAAAGCT
TCATCAGTTCTCGAGTTCTCCCTTCGGTGGGAAGAAATCGACGAGCAATTTGATTTGCTAAAGCAACGAGCCATGGAAGT
GGATTTAAAAGAGGAATCTTTAAGGAAGCAGGTTCTGGAGCTGGATAAGAGGGAAGAGCGAGTGAAGCTGGTTGAAGAGA
GAGAGAGGGGGAGGGCTGAGTTGATTGAAAAGGAAGCTCAGTCTCTGGAAGCAAATGTGGTGGGACTAGTTCTTCAGATG
CAGAATGAAGAAATGGTGGGTTCTCAACTTAACTCACGAGAGAAATTGCTTGGTTTGCTTCAGGATTCGATGATGAAGAA
ACATGAAGGGTTGATTGCTGAGCTTGAAGCGAGGGAAAAGGAGGTTGCTTTGCTTTCTAAGTCGATCGATGAGAAATCTT
TTGACTTTGAGATGAAAGTGAAAGACTTTGACCTGAAGCAAACCGCAGAGACTGAGAGAAGGAGAAAAGAAGCTGAGCTG
ATGGAAGCATCTCTTAGAGAACTTGAAGCGAGGGAGTATGCGCTCAGGTTGCTTAATGACACCATTAGAGAGAAATCGGC
TGCACTGGAGAAGAAAGAAGAGAACTTTCAACTAAAACAAGAAGAAGTAGCTAGTGCGATCGATGTGAAGCGCAAGTCCC
TTGAGTTAAAGGAAAAAGAACTTGAAGAAAGAGAGAAAGAGATTGAATTGAAACAGATAGAAGACGAAGAACTATCAATG
CAAGCATTGACTCGGAAGAGATCTAGGCTGGAATCGGGGCTTTCATTGGTGGCAACGAAGGGCAGAGACGCTGAGGCTCA
TACACAACACAACCATAATAATGAAGACAAGGGAAATAATTCGGTTTCTGTAGATTCAGCTTCTAAATCCTCTCCTGTAC
TAATAAGTGAAGCATATGAAGAAGTTGTCTCCAGTGAGAACAGTGATGAGGAACATGAGCCATTACTGTGTGCTGATTCA
GAGTTTAATGATTTCGGCAAGACAATGAGATCTTTCATGGCTGGTCAAGTTTGGGCTCTATATGATAGTATAGATTCTAT
GCCTAGGTTGTATGGTCGGATCAAGAAAATTACTAATCGTGGGTCGAGTCTTCATCTGACATGGTTTGAATCTAAAGATG
AGAAATCTGTTCCTTCTGGTTGCGGGAGGTTCAAGCTGGGGATTACAGAAACCATAAGCGACCTGACCTTTTCTCATGTG
ATGCATCCCATCATACATGGCAGAAACTTCATCGCTGTGATTCCAAGGAGAGGCGAAACGTGGGCTCTTTTCAGAGACTG
GAGCAAAAGCTGGAACAATAACCCGAAACAGCACAAGCCTTCTTATAAGTACGACTTTGTGGAAGTTCTCGTCAACTTCG
ACGACTGTCTAGGAGTTGGAGTGGCCTATTTAGGAAAGGTTGAAGGATTTGTATCGGTCTATGAAAAAGCTGGGCAGCAT
GGAGTCGTCTCACTCATGATCGCACCAGAGGAAATGCAAAGATTCTCTCACAGAGTGCCATCATTTAGGTTGAATGGAGA
GGAGAGAGAGGGAGTTCCCGCTGGTTCTTTCGAGCTAGACCCTGCTGCTATCATCAGTGTTCCACTCAAGCCTGATCGCT
CCATCCGTGAGGAAGCAGAAGAAACAGCAAGGCAGAGCGAGGATTGTGGTAAAACTTGTGAGGTTGATGATCAAGATGGG
TTAAGAAAAGATTTCCCCATTATCTTAGATTGA