Details for Capsella Locus Carubv10016283m

Position : scaf_3 ( 5`- 1559442 .. 1560838 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016283m

Protein [Map View]
MEYLRVFALVPKISFFSNSRNSISPLFIPSCRGKSREDPLSSSSPYSILGVEPSCSSSELKAAFRAKVKQYHPDVNKERS
NSDIMIRRIIQAYEVTLTVFYTIECLDPFDHPECEALEVFVNEVLCVGKGCSYPCFKTAPHVFSCDTTGTARAMSQGHGE
DYRVQSAVNQCPRNCIHYVTPSQRIILEELLDRYSLWVLILISRPKSSVLEKPYDCSAEAEFLYALIVKAQFENNRYQKP
KRKQPESSGKHVDWF*

DNA
ATGGAATATCTTCGTGTATTTGCTTTGGTACCTAAAATCTCTTTCTTCTCCAATTCAAGAAATTCAATTTCTCCGCTGTT
CATCCCGAGTTGCAGAGGGAAAAGCAGAGAAGATCCACTCTCTAGCTCTTCACCGTACTCAATACTTGGAGTAGAGCCAA
GCTGCTCATCTTCCGAGCTTAAGGCAGCTTTTCGTGCCAAAGTGAAACAATACCATCCTGATGTAAACAAAGAGAGAAGC
AACTCTGATATTATGATTCGTCGCATAATCCAGGCATATGAGGTCACTTTAACTGTGTTCTACACTATAGAATGCTTGGA
CCCTTTTGACCATCCAGAGTGTGAGGCACTTGAAGTGTTTGTAAATGAAGTTCTCTGTGTTGGAAAAGGATGTTCGTATC
CATGCTTTAAAACAGCTCCTCATGTCTTCTCATGTGATACAACTGGAACAGCTCGAGCAATGTCCCAAGGGCATGGCGAA
GATTATCGTGTACAATCTGCAGTTAATCAGTGCCCGAGAAATTGCATACATTATGTCACACCATCACAGAGAATTATTTT
AGAAGAGTTACTTGACAGATATTCTCTGTGGGTGTTAATACTCATTTCTCGTCCTAAGTCCAGTGTCTTGGAAAAACCTT
ATGATTGTTCCGCGGAAGCAGAGTTTCTCTATGCTCTTATCGTCAAAGCTCAGTTTGAGAACAATCGGTACCAGAAACCA
AAGAGGAAACAACCTGAATCTTCAGGAAAACATGTAGACTGGTTCTAA