Details for Capsella Locus Carubv10016264m

Position : scaf_3 ( 5`- 4196464 .. 4197524 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016264m

Protein [Map View]
MASSIPQLYGADFTAFSGETSSQFHGSSSCPDVDSALYSYLDDCYGSFNTSSSNPAESIFLPQLFGISDVSAPPDEYNNY
YQKMSVNNNATQYFHGGDQEYYGFSPEIKPSFRPATGEQSWGNSEGGIQAEPNIKVGRYSVEERKDRIMRYLKKKNQRNF
NKTIKYVCRKTLADRRVRVRGRFARNNDTCEEQSPMSKNHNNHSEKEEDMFSGSDDYLIQMEHDDGWLHEAMSNLIPFPC
EFDAPGDAHHSNTWSF*

DNA
ATGGCATCATCTATTCCTCAGTTATACGGCGCTGATTTCACAGCATTTTCCGGCGAGACTTCTTCGCAGTTTCACGGCTC
TTCTTCATGTCCTGACGTGGACTCAGCGTTATATAGCTACCTTGACGACTGTTATGGCTCCTTCAACACCTCTTCTTCTA
ATCCAGCAGAATCCATCTTCTTACCCCAACTTTTTGGAATCTCTGACGTCTCTGCGCCGCCTGATGAATACAACAACTAT
TACCAGAAAATGAGTGTGAATAATAATGCTACACAATACTTTCACGGTGGGGATCAAGAATACTACGGTTTTTCACCGGA
GATCAAGCCCTCGTTCCGTCCGGCCACAGGAGAGCAATCATGGGGAAATAGTGAAGGAGGGATACAAGCTGAGCCAAACA
TAAAAGTGGGACGCTATTCGGTGGAGGAACGTAAAGACAGGATCATGAGGTACTTGAAGAAAAAGAACCAACGCAACTTC
AATAAGACCATCAAGTATGTTTGCCGTAAAACCCTAGCCGACCGGCGTGTTCGCGTTCGGGGACGATTTGCCAGAAACAA
TGACACATGCGAAGAACAATCTCCCATGTCTAAGAATCACAACAACCATTCTGAAAAAGAGGAAGATATGTTTTCAGGAT
CAGACGACTATCTGATCCAGATGGAACACGATGACGGATGGCTTCACGAAGCAATGTCCAACCTCATCCCTTTTCCTTGT
GAATTTGACGCACCTGGAGATGCTCATCATTCAAACACTTGGAGCTTCTGA