Details for Capsella Locus Carubv10016259m

Position : scaf_3 ( 5`- 847609 .. 849052 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016259m

Protein [Map View]
MKLFDAHCHLQDKRVIDKASELISAALAVGVTNFAVNGTSEKDWDLVKEMGETYPSVVPCFGIHPWFIADRSPHWFNTLK
KLFETNPTAAVGEIGLDKGPLAAGIDYSDQLVVFRPQLELAKELNKPVAVHCIDAFDDLLEIMRSVGPFPAGVILHSFNG
SAEVVPKLAELGAYFSFSGWFTYIDEKVAKKTSKSIPSDRFLLETDSPDGLPKSDESSSDPKPTLNEPANILAVLDYVAN
LSNMKKEEVAELSYVNTVRLFSYPGSKLLTEQ*

DNA
ATGAAGTTGTTTGATGCTCATTGTCACCTCCAAGACAAGAGGGTCATCGACAAAGCCTCCGAGCTCATATCTGCGGCTTT
AGCTGTTGGTGTTACCAATTTCGCAGTCAACGGAACCTCCGAGAAAGATTGGGACTTGGTGAAAGAGATGGGAGAGACGT
ATCCTTCTGTTGTTCCTTGCTTTGGAATTCATCCTTGGTTTATTGCTGATAGAAGTCCTCATTGGTTTAACACATTGAAG
AAGTTATTTGAGACCAATCCTACTGCTGCTGTTGGAGAAATTGGGTTAGACAAAGGTCCCTTAGCAGCAGGAATTGATTA
CTCAGACCAGCTAGTCGTGTTTCGCCCACAGCTTGAACTTGCAAAAGAGCTGAACAAACCTGTAGCAGTTCATTGCATCG
ATGCATTCGATGATCTGCTCGAGATAATGAGATCTGTAGGGCCTTTTCCTGCTGGTGTGATTCTTCATTCATTCAATGGT
TCAGCTGAAGTTGTTCCTAAACTCGCAGAGCTTGGTGCATACTTCTCTTTTTCTGGCTGGTTCACTTACATTGATGAGAA
AGTTGCAAAGAAGACCTCGAAATCGATTCCTTCCGATAGGTTCTTACTGGAGACGGATTCACCCGACGGGTTACCAAAAT
CAGATGAGAGTTCTTCGGATCCAAAACCAACTCTTAATGAGCCTGCAAACATTCTTGCTGTACTAGATTATGTTGCGAAC
CTGTCAAACATGAAGAAAGAAGAGGTGGCGGAGTTAAGTTATGTAAACACTGTGAGGTTGTTCTCTTATCCAGGTTCTAA
ACTGCTTACAGAACAGTAA