Details for Capsella Locus Carubv10016257m

Position : scaf_3 ( 5`- 2431817 .. 2433975 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016257m

Protein [Map View]
MSCPIFAVASVIYIYILAVTIQHNAHPNQTNSFRKLKTLGPEKHLPWHKIQGFGTRENRFGPPMNSAGAVSDGRLTAEDF
SVAARAFADKWKTHNQSFPPWSWVPLINRTLLLSNQAEGYLSLEKSIILSSLEVQNQENEAHYYDFHLVYSASYKVPVLY
FRGYCSDGQPLSLDVIKKDLPSCSVSLLAESKWTFITQECIIWLFGIECLCNNQPQEHPYLNRPWFKLHPCGTEDWIKLL
SQSSISAGCQMPVELYLVSWFSVVGQVVGLRIPLEMLN*

DNA
ATGAGCTGTCCAATCTTTGCTGTTGCTTCAGTCATATATATCTACATCTTAGCAGTAACAATTCAGCACAATGCACACCC
CAATCAAACAAACTCATTCAGAAAACTCAAAACTTTAGGACCTGAAAAACATTTACCTTGGCACAAAATCCAGGGTTTTG
GAACCAGAGAGAACAGATTTGGTCCTCCGATGAATTCAGCTGGTGCGGTCAGCGACGGTAGGCTCACCGCGGAAGATTTC
TCTGTAGCCGCTCGAGCTTTTGCCGATAAATGGAAAACTCATAACCAATCATTCCCTCCATGGTCATGGGTTCCTCTGAT
CAATCGAACTCTACTTCTTTCAAATCAGGCGGAAGGTTACTTGTCGCTCGAGAAGAGCATCATTCTCAGTTCACTTGAGG
TCCAGAACCAAGAAAATGAAGCACATTACTATGATTTTCATTTAGTTTACAGTGCATCATACAAGGTTCCTGTGTTATAT
TTTCGCGGATATTGCAGCGATGGACAACCTCTATCTTTGGACGTCATAAAAAAGGATCTGCCCTCATGCTCTGTTAGTCT
TTTGGCTGAATCTAAGTGGACGTTTATAACACAGGAGTGTATCATTTGGTTATTTGGTATTGAATGTCTATGTAACAATC
AACCGCAGGAGCATCCATATTTGAACAGGCCATGGTTCAAGCTACATCCCTGTGGGACTGAGGATTGGATCAAGCTGCTT
TCCCAAAGTAGCATCTCTGCTGGATGCCAGATGCCAGTTGAGTTGTATTTGGTTTCATGGTTCTCTGTTGTCGGGCAGGT
TGTTGGTCTTAGGATCCCTCTTGAGATGCTGAATTAG