Details for Capsella Locus Carubv10016253m

Position : scaf_3 ( 5`- 1527349 .. 1529043 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016253m

Protein [Map View]
MKKHYKPILSQLENCRFMVELNQLHGLMIKSSVIRNVIPLSRVIDFCTTSPETMNLSYARSVFESIGCPSVYIWNSMIRG
YSNSTNPDKALIFYEEMLRKGYSPDYFTFPYVLKACSGLRDVQFGSCVHGYVVKTGFGVNMYVSTCLLHMYMCCEEVNCG
LRVFEDIPKWNVVAWGSLISGFVNNNRFSEAIQAFRDMQSIGVKPNETIMVDLLVACGRCKDIAAGKWFHGFLKELGFDP
CCQSKGIGFTVILATSLIDMYAKCGELRTARYLFDGMPERNLVSWNTIITGYSQNGDAEEAMHMFLELRSAGFAPDKVTF
LSMLRASMIQGCSQLGQTIHAYVSKAGFMKDAAIVCALVNMYAKTGEAESAKQAFEDLEKKDTIAWTIVIIGLASHGHGN
EALSIFQRMQDESNATPDGITYIGVLYACSHIGLVEEGRRYFAEMRDLYGIEPTAEHYGCMVDILSRAGYFDEAERLVKT
MPVQPNANIWGALLNGCEIHENINFADRIKSMVAESEELGSGIYVLLSNIYAKAGRWTDVRLIRESMKSKQIAKLLGHSS
VEIM*

DNA
ATGAAGAAGCACTACAAACCAATTCTCTCGCAATTGGAGAATTGCAGATTCATGGTGGAACTGAATCAACTCCATGGGTT
GATGATCAAGTCCTCAGTTATCAGAAACGTCATTCCTCTAAGCCGAGTCATAGACTTCTGCACTACTTCTCCCGAGACTA
TGAATCTCAGCTACGCTAGATCAGTTTTCGAAAGTATTGGTTGTCCAAGCGTGTATATATGGAACTCGATGATCAGAGGC
TACTCGAACAGTACAAACCCAGATAAAGCATTGATCTTTTACGAAGAAATGCTTCGAAAAGGGTATTCTCCGGATTATTT
CACTTTTCCTTATGTTCTTAAAGCTTGTTCTGGGTTAAGGGATGTTCAATTTGGGAGTTGTGTTCATGGGTATGTTGTGA
AAACTGGGTTTGGAGTGAATATGTATGTTTCTACTTGCTTGCTTCATATGTATATGTGTTGTGAAGAAGTGAATTGTGGT
TTGAGGGTTTTTGAGGATATCCCAAAGTGGAATGTTGTTGCTTGGGGAAGTTTGATTTCTGGGTTTGTGAATAATAATCG
GTTTAGCGAGGCTATTCAAGCGTTTAGGGATATGCAGAGTATTGGTGTGAAGCCAAATGAGACAATAATGGTGGATCTTT
TGGTTGCTTGTGGTAGATGTAAAGACATTGCGGCTGGGAAATGGTTTCATGGGTTTCTTAAAGAATTAGGCTTTGATCCA
TGTTGTCAGTCAAAAGGGATAGGCTTTACTGTGATATTGGCTACAAGTCTCATTGATATGTATGCAAAATGTGGAGAGCT
GAGAACCGCAAGGTATCTGTTCGATGGAATGCCTGAAAGAAACTTGGTTTCTTGGAACACCATTATCACAGGGTATAGTC
AGAACGGTGATGCAGAGGAAGCAATGCATATGTTTTTGGAATTGCGTTCTGCAGGTTTCGCTCCAGATAAAGTAACCTTT
TTGAGTATGCTCAGAGCTTCCATGATTCAAGGATGTTCACAGTTGGGACAAACGATTCATGCATATGTTTCAAAAGCTGG
CTTTATGAAGGATGCTGCAATAGTTTGTGCACTTGTGAATATGTATGCTAAAACAGGTGAAGCTGAGAGCGCAAAGCAAG
CGTTTGAAGATTTGGAGAAGAAAGATACAATAGCTTGGACCATTGTGATCATCGGGTTAGCCAGTCATGGGCACGGGAAT
GAAGCATTGAGTATATTCCAGCGAATGCAAGATGAAAGTAATGCTACACCTGATGGAATTACATATATTGGGGTTCTATA
TGCTTGCAGCCACATAGGTCTGGTCGAAGAAGGACGAAGATACTTTGCGGAAATGAGAGATCTTTACGGCATTGAACCAA
CTGCTGAACACTATGGATGTATGGTTGATATCTTGAGCCGTGCTGGTTATTTTGATGAAGCAGAGAGATTGGTGAAGACT
ATGCCAGTACAACCCAATGCTAATATATGGGGTGCATTGTTAAATGGTTGTGAGATACATGAAAATATAAATTTCGCAGA
TCGGATAAAATCCATGGTTGCTGAATCAGAAGAACTCGGTAGCGGAATCTATGTTCTTCTATCAAATATATATGCCAAAG
CTGGCAGATGGACTGATGTAAGGCTAATTAGAGAATCCATGAAAAGCAAACAGATAGCTAAACTTTTAGGTCATAGTTCT
GTTGAAATAATGTGA