Details for Capsella Locus Carubv10016246m

Position : scaf_3 ( 5`- 3510983 .. 3511468 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016246m

Protein [Map View]
TRQELDTLAESEIKNRDVVLKLYEALRSRDVDSVHQILTPDLEYWFHGPPPHQFLMRMLTGGVSPSFEFVPLSVVSFGST
VIAEGCDAATSVSWIHAWTVANGIITQVREYSNTSLTVTRIGNVVAGRRSPEIAPSHCPSVWESQFSGRAGKSVPGLVLA
I*

DNA
ACTCGCCAAGAACTGGATACTCTGGCGGAATCAGAGATCAAGAACCGAGACGTGGTTCTGAAGCTGTATGAAGCCCTGAG
ATCTCGCGACGTCGACTCCGTTCACCAGATCCTAACCCCAGATCTGGAGTATTGGTTCCACGGCCCTCCGCCGCACCAGT
TTTTGATGCGCATGCTCACCGGAGGTGTCTCTCCATCTTTCGAGTTCGTTCCTCTCTCCGTCGTCTCCTTCGGGTCCACC
GTCATCGCTGAAGGCTGCGACGCCGCCACCTCTGTTTCTTGGATCCACGCTTGGACCGTAGCGAATGGGATAATCACTCA
GGTGAGGGAGTACTCTAACACTTCTCTCACCGTCACGCGGATCGGTAACGTTGTTGCTGGACGACGCTCCCCTGAGATTG
CTCCCTCGCATTGCCCCTCCGTCTGGGAAAGCCAATTCTCGGGTCGGGCTGGTAAATCCGTACCCGGTTTGGTTCTCGCG
ATTTGA