Details for Capsella Locus Carubv10016242m

Position : scaf_3 ( 5`- 3601169 .. 3603758 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016242m

Protein [Map View]
MSSKKAKTKNEASSSRGGIGGESIVADCGRNRSTCGYCKSSTRSSISHGLLTESLTVNDYQALLDRGWRRSGCFLYKPEM
EKTCCPSYTIRLKASDFVPSKEQQRVRRRLERFLDGELDAKSSEQTEERDISFSREVSVSVRESLGVANREQNNQVEPIM
KDLSEKIDDAVQRCIQSGEFPSNIQIPKASVKRVISAKRKKLAEGSEELLYTSNIAFPIVAAIRHTETSVKGEKNKNVEE
NRLSPEVVSEKLLSAMNKVGEFTAFSVKVCKGHINFLSATRVTSLDRNEGEESLGTTSTKSSLNNLHARKRKLEMLLKRS
SFDPEEYELYKRYQLKVHNDKPESISETSYKRFLVDTPLIEVPPSGYDDEEKIPPCGFGSFHQQYRVDDRLIAVGVIDVL
PKCLSSKYLFWDPDFASLSLGNYSALQEIDWVKQNQAHCSTLEYYYLGYYIHSCNKMRYKAAYRPSELLCPLRYQWVPFE
VAKPLLDKKPYSVLSNYTNVSLSSSSPQASETLVESTSEHEDMEKGNTNNDGDEDDEMYNSDEDSGSSRNRSDITNILIS
LDGPRLRYKDIPRIKNPVVEKQLESMLVNYRKVVGAELSERMVYELR*

DNA
ATGTCGTCGAAGAAAGCGAAGACGAAAAATGAGGCAAGTAGCAGTCGTGGTGGCATCGGCGGAGAGAGTATAGTCGCCGA
CTGTGGACGTAACAGATCCACTTGCGGTTACTGTAAATCATCTACCCGCTCCAGTATCTCTCACGGGTTATTGACAGAGA
GTCTCACCGTTAATGACTACCAAGCTCTTCTTGACCGTGGATGGAGACGATCTGGCTGCTTCCTTTACAAACCTGAGATG
GAGAAAACTTGTTGCCCTTCTTATACAATCCGCTTGAAAGCTAGTGATTTTGTTCCTTCTAAGGAGCAGCAGCGAGTGCG
TAGAAGACTGGAAAGGTTCTTGGATGGCGAACTAGATGCGAAATCGAGCGAGCAGACAGAAGAGAGAGACATTTCTTTCT
CCCGCGAAGTTTCAGTGTCAGTAAGAGAATCACTTGGAGTTGCTAATAGAGAACAAAACAATCAAGTGGAACCAATCATG
AAAGATTTGTCTGAAAAAATTGATGATGCGGTACAAAGATGCATACAAAGTGGGGAGTTTCCTTCTAATATTCAGATTCC
CAAAGCTTCAGTGAAGAGAGTTATCTCTGCAAAAAGGAAGAAACTTGCTGAAGGGTCAGAAGAACTCTTATACACCAGCA
ATATTGCTTTTCCAATAGTAGCTGCTATTAGGCACACAGAGACATCTGTGAAAGGCGAGAAAAACAAAAACGTAGAAGAA
AACAGATTATCACCAGAGGTTGTTTCTGAGAAGCTGTTAAGTGCAATGAATAAGGTGGGAGAATTTACTGCCTTTTCTGT
TAAGGTCTGCAAAGGCCATATCAACTTCCTTTCAGCTACCCGAGTTACTTCCTTAGATAGAAATGAAGGTGAAGAAAGCC
TTGGTACTACATCAACAAAGTCTTCTTTAAACAACCTTCATGCAAGAAAGAGGAAGCTGGAGATGCTCTTGAAAAGGTCG
AGTTTTGATCCAGAGGAATATGAATTATACAAACGGTATCAACTGAAAGTGCACAATGATAAGCCGGAGAGCATCTCAGA
GACTTCATACAAAAGGTTTTTGGTTGACACTCCATTGATTGAAGTTCCGCCTTCAGGTTATGATGATGAAGAAAAGATTC
CTCCTTGTGGTTTCGGTTCTTTCCATCAACAATATCGAGTTGATGACCGTCTAATTGCTGTTGGGGTGATCGATGTTCTT
CCTAAATGTTTGTCAAGTAAATATCTATTCTGGGATCCAGATTTTGCATCCTTGTCTCTTGGAAACTACTCAGCCTTGCA
AGAAATCGATTGGGTAAAACAAAACCAAGCTCATTGCTCTACCCTTGAGTATTACTATCTTGGCTATTACATACATTCCT
GCAACAAAATGAGATATAAAGCAGCCTATCGTCCATCCGAGCTTCTATGTCCTCTCCGTTACCAATGGGTTCCATTCGAA
GTAGCCAAGCCTCTGCTTGATAAGAAGCCATATTCCGTCTTGTCCAATTACACTAATGTTTCTCTATCATCATCATCACC
TCAAGCTTCTGAAACCCTAGTGGAATCCACGAGTGAACATGAAGACATGGAAAAAGGGAATACAAATAATGATGGTGATG
AGGATGATGAAATGTATAACTCTGATGAAGACTCAGGCTCTAGCAGAAACCGGAGTGACATTACCAATATCCTTATCAGT
CTTGATGGACCTCGACTTCGATACAAGGATATACCACGGATCAAGAATCCTGTGGTTGAGAAACAACTGGAATCGATGTT
GGTTAATTACCGGAAAGTCGTGGGGGCAGAGCTCTCGGAGAGAATGGTGTATGAACTACGGTAA