Details for Capsella Locus Carubv10016217m

Position : scaf_3 ( 5`- 4691434 .. 4693581 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016217m

Protein [Map View]
NSNLVDASSIHFYVGKRNFCKKVGKKANERNRKVFCGYNTGDDDTNKHNSDRPILKSSEEDKEMEEIEKGRRIGSKPPSC
EKKCYGCEPCEAVQVPTISSMPHLSPHYANYQPEGWRCHCAP*

DNA
AATTCAAATCTGGTAGATGCCTCTTCGATTCATTTCTACGTTGGAAAAAGAAATTTTTGTAAGAAAGTAGGAAAAAAGGC
GAATGAGAGAAATAGGAAAGTGTTTTGTGGTTATAATACTGGTGATGATGATACAAATAAGCACAATTCAGATAGGCCCA
TATTGAAATCAAGTGAGGAGGATAAAGAGATGGAAGAAATAGAGAAAGGAAGAAGAATAGGATCAAAGCCACCAAGTTGT
GAGAAGAAATGCTATGGATGTGAGCCATGTGAAGCCGTCCAAGTCCCTACCATTTCGTCGATGCCTCACCTCTCTCCTCA
TTATGCTAATTACCAACCTGAGGGTTGGAGATGCCATTGTGCCCCTTAA