Details for Capsella Locus Carubv10016209m

Position : scaf_3 ( 5`- 5475999 .. 5478072 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016209m

Protein [Map View]
MGNSCLACFDKSKATTTVDVPLNGSKDVLVEEDWSELRNPSVASEEFWTNTTLDMESNAQGSVSSISTTNLTVDSQGCGS
SSNEPAEFVNNGLVGAVTRIQDRVKIFLAVFFWMSLFFWVTVTDGRGKGKGKKGSRFK*

DNA
ATGGGCAATAGTTGTTTGGCTTGTTTTGATAAGTCGAAAGCAACAACAACTGTAGATGTGCCTTTGAATGGCTCAAAAGA
TGTGTTAGTAGAAGAAGATTGGAGTGAGCTGAGGAACCCTAGTGTAGCTTCTGAAGAGTTCTGGACAAACACCACTTTAG
ATATGGAAAGCAATGCTCAGGGAAGTGTTTCTTCAATCAGTACGACGAATCTGACTGTTGATTCTCAAGGATGTGGTTCC
AGCTCTAATGAACCTGCTGAGTTTGTTAACAATGGTCTTGTGGGAGCTGTGACAAGGATACAAGACCGAGTAAAGATCTT
CCTAGCAGTGTTTTTTTGGATGTCTCTCTTCTTCTGGGTTACAGTGACAGATGGGAGGGGTAAAGGAAAAGGCAAGAAAG
GTTCACGTTTCAAATAG