Details for Capsella Locus Carubv10016208m

Position : scaf_3 ( 5`- 5762836 .. 5763954 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016208m

Protein [Map View]
MAHEEKLPFELTEEILSRVPQNSLVRFRSVSKQWNALFDDRTFINNHKKTFRFILTTKYKIYSVSIDPKIEVRDLTLDIP
GLESQIPKNLVDCDKLLLCDMEKGAAVWNPWLRQARLINQDLDQTQIQSYGIGYNNKGSYKVVASCGRKGVSLNGNLYWV
CYYDKTDPVYHLTKFNSCSERFFRFCYLNCGTTNFLKDVLVLRVFNGDRFSLLKQCHATKKIEIWVNKYKINSELDNEEN
MEWIKFMEMSSPNLPDLVETRFNSPPSYFIEDKRLVVCSCDETGRAWIYVLGQNKLISKTQIHSLTDLWPSHCTFIPSLV
PVPRGGREEVAELQV*

DNA
ATGGCGCATGAGGAGAAGCTTCCATTTGAGTTGACTGAAGAAATACTCTCTCGTGTCCCACAAAACTCTCTTGTTCGCTT
CCGATCCGTATCAAAACAATGGAACGCTCTCTTCGACGATAGGACCTTCATCAACAACCACAAGAAGACGTTTCGATTCA
TTTTAACAACCAAATACAAAATCTATTCAGTAAGCATCGATCCCAAGATAGAGGTGCGTGACTTAACCTTGGATATTCCC
GGTTTAGAATCTCAGATACCTAAAAACTTGGTTGATTGCGATAAATTATTGCTATGTGACATGGAGAAAGGAGCTGCCGT
TTGGAACCCGTGGCTGAGACAGGCTAGATTGATCAACCAGGATTTAGACCAAACTCAAATTCAATCTTATGGCATAGGAT
ACAACAACAAAGGGAGTTACAAGGTCGTTGCTTCTTGTGGTCGGAAGGGTGTCTCGTTGAATGGAAATTTGTATTGGGTT
TGTTACTATGACAAGACTGATCCTGTTTATCACCTAACTAAATTCAACTCTTGCAGCGAAAGATTCTTCCGGTTTTGTTA
TCTAAATTGTGGGACGACAAATTTTCTTAAGGATGTTCTTGTCCTCAGGGTTTTTAATGGAGATCGGTTTTCGTTGTTAA
AGCAATGCCATGCAACAAAGAAGATTGAGATTTGGGTGAACAAGTACAAGATTAATAGTGAACTTGATAATGAAGAAAAT
ATGGAGTGGATAAAGTTCATGGAAATGTCAAGTCCTAACTTGCCGGATTTGGTAGAAACCAGATTCAACTCTCCGCCAAG
TTACTTCATTGAAGATAAAAGGCTTGTTGTGTGCTCATGCGACGAAACTGGTCGGGCTTGGATCTATGTTTTGGGGCAAA
ATAAGTTGATCAGTAAAACTCAAATACATTCTCTGACGGATCTTTGGCCTTCGCATTGTACCTTTATTCCCAGTTTGGTA
CCGGTTCCTCGAGGTGGACGTGAAGAAGTAGCGGAATTACAAGTTTGA