Details for Capsella Locus Carubv10016206m

Position : scaf_3 ( 5`- 3814032 .. 3814904 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016206m

Protein [Map View]
MAIVSPHFCAPYPIELGIVRKVMTLTDGNFAVTDVNGNLLFKVKEPLFSLSDKRILLDASDTPILTLRENKVSLHDRWQV
FRGKSTDQSDLVYTLKRSSMIQIMKPKLDIFLAQNKEMKVCDFHVKGSWIDRSCVVYAGKSDAIVAQMQKKHTAQSILIG
KSNFSVTVYPNVDFAFIVSLIVILDDINREDSED*

DNA
ATGGCGATCGTAAGTCCCCATTTCTGTGCACCGTACCCCATAGAGTTGGGGATCGTACGCAAGGTGATGACTCTAACAGA
TGGTAACTTCGCTGTCACCGACGTCAACGGCAATCTCCTTTTCAAGGTCAAAGAACCTTTGTTTAGCCTCAGCGACAAAA
GGATTTTGTTGGATGCATCAGACACTCCAATCTTGACTTTGAGAGAAAATAAGGTGAGCTTGCATGATAGGTGGCAAGTA
TTTAGAGGGAAAAGTACAGACCAAAGTGATCTAGTATACACATTGAAACGATCGTCGATGATTCAAATAATGAAGCCAAA
GCTAGACATTTTTTTGGCTCAAAATAAAGAAATGAAGGTGTGCGACTTCCATGTCAAAGGAAGTTGGATCGACCGTTCAT
GTGTCGTCTACGCCGGCAAATCTGATGCCATTGTTGCTCAGATGCAAAAGAAACATACCGCACAAAGCATATTGATAGGG
AAGAGTAATTTCTCGGTTACGGTCTATCCAAATGTTGACTTTGCTTTTATAGTCTCTCTCATTGTAATTCTCGATGACAT
TAACCGAGAAGATTCAGAAGACTAA