Details for Capsella Locus Carubv10016204m

Position : scaf_3 ( 5`- 8030088 .. 8030716 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016204m

Protein [Map View]
MAVPIHFLINSPHGSSDDEFYDSEISYSSEDDESMEEEAESSSVLVNTNAGSRSSLLSDLEHDETELDGGTSEERFWVQY
PYLKELVEIIVAQGLISENIAFERVKLIGDDKAKELNDGWKALCIREQDLGNQMLQLLASAMK*

DNA
ATGGCGGTTCCGATTCACTTCCTCATCAACTCTCCACATGGATCATCCGACGACGAGTTCTACGATTCGGAAATTTCCTA
TTCATCTGAAGACGACGAGTCAATGGAAGAAGAAGCCGAATCGTCGTCCGTGTTAGTAAACACAAACGCAGGCTCTCGCT
CTTCTCTTCTCTCCGATCTCGAACATGACGAAACTGAGCTTGATGGTGGTACTAGTGAGGAGAGGTTTTGGGTTCAGTAT
CCGTATCTGAAGGAGTTAGTGGAGATTATTGTAGCTCAAGGTTTGATCTCTGAGAACATTGCTTTTGAGAGAGTCAAGCT
TATTGGTGATGACAAGGCTAAAGAGTTGAATGATGGATGGAAGGCTTTGTGTATTAGGGAGCAAGATTTGGGTAACCAGA
TGCTTCAGCTTCTTGCTTCTGCCATGAAATGA