Details for Capsella Locus Carubv10016199m

Position : scaf_3 ( 5`- 5412112 .. 5415378 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016199m

Protein [Map View]
TTIRRLQRGKRRKLFYRKLSRRSGEDPYNAEHTMTSRMLRNTCIREGEVVVSREITLLSGGNKTSSEIEVMYSLSRILRR
SRSYSFASTSFGAVSKLEEVSSCDKERVFKSSGLIYNKSQGLIRLYTTRNVFSRFFGINKLSSVADAGDKGVEEVKEEEL
SESEEVLPVSGDVTEGVAHNGSLFESELGNDVEASADDDPEIEVGHSKDGKTTKKRVSSELYESIVAYKSVKHVLEKWVK
EGKCLSQAEVSIAIHNLRKRRFYDMGLQLWEWLRANTQFEFTEANYASQLDLVSKVHGLQKAENFLKDIPETLRGEVVYR
TLLANCVLKHHVNKAEDLFKKMRELKFPTSVFACNQLLLLYSMHDRKKIADVLLLMEKENVKPSRGTYLFLINSKGLAGD
ITGMEKIVETMKEEGIELDPELQSSLAKYYIRGGLKERAQEVMKEMEGKGLKQTPWVCRSLLPLYADIGDTDNVRRLSRF
VEENPRYDNCISAIRAWGKLKEIEEAEAVFERLVKKYNIFPMLPYFSLMEIYTENKMLAKGKELVKRMGNAGIKIGPSTW
HALVKLYVKAGEVGKAELILNRATKDKKMRPMFISYMLILEEYAKRGDVHNAEKVFLGMKNAGYASQLMQYETVLLAYIK
AKTPAYGMIQRMKADNVYPNKTLAVKLAQVDPFRKSPVSALLDE*

DNA
ACGACGATTCGAAGACTACAGAGAGGAAAGAGGAGAAAGCTTTTTTACCGGAAGCTGAGTCGTCGATCGGGAGAGGATCC
GTACAATGCAGAACACACGATGACCTCGCGGATGCTTCGAAATACGTGTATACGAGAAGGAGAAGTAGTAGTCAGTAGAG
AAATCACACTTCTCTCCGGCGGAAATAAAACCTCCTCAGAAATTGAAGTAATGTATTCGCTTTCGAGGATTCTCCGAAGG
AGTCGGAGTTATAGCTTTGCATCCACTTCGTTTGGTGCGGTTAGTAAATTAGAAGAAGTATCAAGTTGTGACAAAGAAAG
GGTCTTCAAATCATCTGGATTGATTTACAACAAATCTCAAGGTTTAATCAGACTTTATACCACAAGAAATGTGTTTTCAC
GCTTCTTTGGCATCAATAAGCTTTCTTCTGTAGCCGATGCTGGAGACAAAGGAGTTGAGGAAGTTAAGGAAGAGGAGCTG
TCTGAATCAGAGGAGGTGCTTCCTGTTTCTGGGGATGTAACAGAGGGAGTTGCTCATAATGGTTCTTTATTCGAGTCTGA
GCTTGGTAATGATGTAGAAGCGTCCGCTGATGATGATCCTGAAATCGAAGTAGGGCATTCAAAAGATGGGAAAACAACAA
AGAAAAGAGTGAGCTCTGAGCTGTATGAATCTATTGTTGCCTATAAATCTGTGAAGCATGTTCTTGAAAAATGGGTCAAA
GAAGGGAAATGTTTGAGTCAAGCTGAGGTTTCTATTGCTATACATAATCTGCGTAAACGCAGATTTTATGATATGGGTTT
GCAGCTGTGGGAGTGGCTGCGAGCTAATACCCAATTTGAGTTCACAGAGGCAAACTATGCTTCTCAACTGGATTTGGTGT
CTAAAGTACATGGTCTACAAAAAGCCGAAAACTTTTTGAAGGATATTCCTGAAACTTTGAGGGGAGAAGTAGTGTACAGA
ACCCTGCTGGCAAATTGTGTACTTAAGCACCATGTGAACAAAGCCGAAGACCTTTTTAAGAAAATGAGAGAACTAAAATT
TCCAACAAGCGTGTTTGCTTGCAACCAGTTGCTTCTCCTCTACAGTATGCATGATAGGAAGAAGATAGCTGATGTTTTGT
TACTCATGGAGAAAGAAAACGTCAAGCCGAGTCGTGGTACCTATCTGTTTTTAATCAATAGTAAAGGTTTAGCCGGGGAC
ATAACTGGAATGGAGAAGATTGTGGAGACAATGAAGGAAGAAGGTATTGAGCTTGATCCAGAACTACAGTCTAGCCTGGC
TAAGTACTACATAAGAGGAGGGCTTAAAGAGCGAGCGCAAGAAGTTATGAAGGAAATGGAAGGGAAAGGCTTGAAACAAA
CTCCATGGGTGTGCCGTTCATTACTCCCTCTTTATGCAGACATAGGAGACACTGACAATGTGAGAAGATTGAGTAGGTTT
GTTGAGGAAAATCCGAGATATGATAATTGCATTTCTGCCATTAGAGCATGGGGAAAGCTGAAGGAAATTGAAGAAGCAGA
GGCAGTGTTTGAGAGGCTTGTGAAGAAGTATAACATTTTTCCTATGCTACCATATTTTTCCCTCATGGAGATATACACAG
AGAACAAGATGCTAGCGAAAGGTAAAGAACTGGTTAAAAGAATGGGAAATGCAGGAATTAAGATTGGCCCTTCAACATGG
CACGCACTTGTGAAGCTCTACGTCAAAGCGGGAGAAGTTGGAAAAGCTGAATTGATATTGAACAGAGCGACAAAGGATAA
AAAGATGAGACCTATGTTCATTTCTTACATGTTGATTCTTGAGGAATATGCAAAAAGAGGCGATGTTCATAACGCGGAGA
AGGTTTTCCTGGGGATGAAAAATGCAGGCTATGCATCTCAGCTTATGCAGTATGAAACCGTTCTCTTGGCTTATATCAAA
GCCAAAACTCCTGCTTATGGGATGATTCAGAGGATGAAGGCAGATAACGTGTACCCGAATAAGACTCTTGCTGTGAAACT
GGCTCAGGTTGATCCATTTAGAAAGAGTCCAGTGTCTGCTTTACTTGACGAATGA