Details for Capsella Locus Carubv10016196m

Position : scaf_3 ( 5`- 468836 .. 470491 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016196m

Protein [Map View]
MAMGRNAEAEQESQVLPRVEKASMYDRSGLTKETRNEVLTKAGSTKGVRHFEFQCVCSTIQYEVGDVVELLSSENPSAID
AFLEHCDLDPKSFITVMSFYATAEHEKERPQYFASPEGRDDLYNYNQEERKHS*

DNA
ATGGCGATGGGAAGAAACGCAGAGGCCGAGCAGGAGTCTCAAGTATTGCCTAGAGTAGAAAAGGCTTCTATGTATGACCG
TAGCGGTTTAACCAAAGAAACCAGAAATGAAGTCTTGACTAAAGCTGGAAGCACAAAGGGTGTCCGCCACTTCGAGTTCC
AATGTGTTTGCTCTACTATCCAATATGAAGTTGGGGATGTTGTTGAGCTCCTTTCAAGCGAAAATCCTTCAGCGATAGAT
GCCTTTTTAGAACACTGCGATTTAGACCCAAAGTCATTCATCACAGTTATGAGCTTCTATGCAACAGCTGAACATGAGAA
GGAGAGACCTCAATACTTTGCATCACCCGAAGGGAGGGATGATCTCTACAATTACAATCAGGAAGAAAGAAAGCATTCTT
GA