Details for Capsella Locus Carubv10016188m

Position : scaf_3 ( 5`- 3029814 .. 3032144 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016188m

Protein [Map View]
METHHFLLFLSLFLPFLSTPGSGFGSSGPIAASFGSSAFFCAIDASGRQDVICWGKNYSSPSSPSSSSSSSSSSLPSSAS
ASYNIPSMAVLSGGDGFLCGILSNTSQAFCFSSLGSSSGMDLVPLAYRTTAYSQIAAGNSHVCAVRGAYYSDHDSGTVDC
WDITRTRNNNSLVASENPNFYDQIVSNLVFNNIVSGDGFSCGGIRDGGLLCFGPNSSHLGFNTTSDNFQVLAAGKNSLCA
ILNSSLEVKCWGEDESFVNSPRDDSRFVALTAGPRHFCGIREDNHEAECWGNSNFSLIPKGSGFKAIASSDFIVCGIREE
DLVLDCWMVNGSSTLAYDPPLELCSPGTCRAGPCNEREFAFNASILNEPDLTSLCVRKELMVCSPCGSDCSHGSFLSSSC
TPNSDRICTACSLCQNSSCSDICKLHNSNFPDKHWHQLQRLVLIIGSCASALLIIIIGCCVVPRIVSSPNKDDGAANQFK
SCIGKPDLETEPLEHISPAPSVTPFAQVFRLSELKDATNGFKEFNELGRGSYGFVYKAVLADGRQVAVKRANAATIIHTN
TREFETELEILCNIRHCNIVNLLGYSTEMGERLLVYEYMPHGTLHDHLHGGFSPLNWSIRMKIAMQTAKGLEYLHNEAEP
RIVHGDVKSSNVLLDSDWVARVADFGLVTSSNEKNLDIRRDVYDFGVVLLEILTGRKRHDRDCDPPEIVNWTAPVIREGK
GAGILDKYIALPRNVEPLLKLADMAELCVRDDPNQRPTMSELANWLEQLTRDALIF*

DNA
ATGGAAACCCATCACTTTCTCCTCTTTCTCTCTCTCTTTCTCCCGTTTCTCTCCACACCCGGATCCGGGTTCGGATCCTC
CGGCCCTATTGCCGCCTCTTTCGGCTCCTCTGCTTTCTTCTGCGCCATTGACGCTAGTGGCCGTCAAGATGTTATCTGCT
GGGGCAAAAACTACTCTTCTCCTTCTTCTCCTTCTTCTTCTTCTTCTTCTTCCTCCTCATCTCTTCCTTCTTCCGCTTCC
GCAAGTTACAACATTCCGTCCATGGCGGTTCTTTCAGGCGGAGACGGGTTTCTCTGCGGCATCCTATCGAACACTTCTCA
GGCGTTTTGTTTCAGTTCACTTGGTTCTTCTTCAGGTATGGATCTTGTTCCTCTAGCTTACAGGACTACTGCTTACTCTC
AGATCGCTGCTGGAAACAGCCATGTCTGTGCAGTTAGAGGAGCTTACTATTCGGATCACGATTCTGGAACTGTCGACTGT
TGGGACATAACAAGAACTAGGAATAACAACAGCTTAGTGGCCAGTGAGAATCCAAACTTCTATGATCAGATTGTTAGTAA
TCTCGTCTTCAACAACATCGTTTCTGGTGATGGCTTTAGCTGTGGTGGAATCAGAGATGGTGGATTGCTCTGTTTTGGCC
CCAATTCTTCTCATTTAGGGTTTAACACGACTTCTGATAACTTCCAAGTCTTAGCCGCCGGGAAAAACTCACTCTGCGCG
ATCCTAAACTCATCCCTGGAGGTGAAATGTTGGGGAGAAGATGAATCTTTCGTCAATTCCCCTAGGGATGATTCTCGATT
CGTCGCCTTAACCGCAGGTCCTCGCCATTTCTGTGGAATCCGTGAGGATAATCATGAAGCTGAATGTTGGGGAAACTCGA
ATTTTTCATTGATTCCAAAAGGTTCTGGATTCAAAGCAATTGCTTCATCTGATTTCATTGTTTGTGGTATCAGAGAAGAG
GATCTTGTTCTTGATTGCTGGATGGTTAACGGGTCATCAACGTTGGCTTACGATCCTCCTTTGGAGCTGTGCAGTCCAGG
GACGTGTCGAGCTGGCCCGTGTAACGAAAGAGAGTTTGCTTTCAACGCAAGTATACTCAACGAACCTGACCTAACGAGTT
TGTGTGTGAGGAAAGAGTTAATGGTCTGTTCACCTTGCGGTTCTGATTGCTCTCACGGATCTTTCTTGTCTAGTTCGTGC
ACCCCGAACTCTGATCGGATCTGCACAGCTTGCTCGCTCTGTCAAAATAGTTCTTGTTCAGACATATGTAAGCTTCATAA
CAGCAATTTTCCTGACAAGCATTGGCATCAACTACAGAGACTTGTCCTCATCATCGGATCTTGCGCATCCGCTCTATTGA
TCATCATAATCGGTTGCTGCGTCGTGCCGCGGATTGTCTCTAGTCCTAATAAAGATGACGGCGCTGCCAATCAGTTCAAG
TCTTGCATAGGAAAGCCCGATTTAGAGACCGAGCCGCTTGAACATATCTCCCCTGCTCCATCGGTGACACCTTTTGCCCA
AGTGTTCAGGCTCTCTGAGCTTAAAGATGCGACCAACGGGTTTAAAGAGTTCAATGAGTTAGGAAGAGGAAGCTACGGGT
TTGTCTACAAAGCCGTGTTAGCTGACGGGAGGCAAGTAGCAGTTAAGAGAGCAAACGCAGCAACCATAATCCACACAAAC
ACAAGAGAGTTCGAGACGGAATTAGAGATTCTCTGCAACATTAGGCATTGCAACATTGTGAATCTCCTCGGTTACTCGAC
GGAAATGGGAGAGAGGCTTCTTGTCTACGAGTACATGCCTCACGGTACCCTTCACGACCACCTACACGGCGGGTTTTCTC
CGTTGAATTGGAGCATAAGGATGAAAATCGCAATGCAAACCGCAAAGGGTCTCGAGTATCTACACAACGAAGCTGAGCCG
AGAATCGTTCATGGCGATGTGAAGTCTTCGAATGTACTTTTGGACTCGGATTGGGTAGCGAGAGTTGCGGATTTTGGGCT
AGTGACATCGTCGAACGAGAAGAACTTGGACATCAGAAGAGATGTTTATGACTTTGGGGTTGTGTTGTTAGAGATTTTAA
CCGGAAGGAAACGTCATGACAGGGACTGTGATCCGCCGGAGATTGTTAACTGGACGGCTCCGGTGATCAGAGAAGGCAAA
GGGGCGGGGATTTTGGATAAGTATATTGCGTTGCCGAGAAACGTTGAACCGTTATTGAAACTTGCTGACATGGCGGAGTT
GTGTGTACGGGATGATCCTAACCAACGACCGACTATGTCGGAACTTGCAAACTGGTTAGAACAGCTCACCAGAGATGCAC
TGATCTTCTAG