Details for Capsella Locus Carubv10016172m

Position : scaf_3 ( 5`- 8257283 .. 8259595 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016172m

Protein [Map View]
MGSLVKKEETSSSLMTEFLEKCGGYAVVDGGFATELERHGADINDPLWSAKCLITSPHLVTKVHLDYLESGANIIITASY
QATIQGFVAKGLSVGEAENLLRRSIEITCEAREIFYNRCTKGSWDFAYAGTASRRPVLVAASVGSYGAYLADGSEYSGIY
GDSVSKETLKDFHRRRVQILAKSGADLIAFETIPNKLEAEAYADLLEEEGIEIPAWFSFTSKDGVTVPRGDSVVECAKVA
DSCKKVVAIGINCTAPRYIHDLIISLRQVTRKPIVVYPNSGEVYDGLNKKWIKSGEESEEDFVSYVSKWRDEGASLFGGC
CRTTPNTIRAIAKVLSSESPAASKLKLKQ*

DNA
ATGGGATCTTTGGTGAAGAAAGAGGAAACGTCTTCGTCGTTGATGACGGAGTTTTTGGAGAAGTGCGGAGGATATGCGGT
GGTGGACGGAGGGTTTGCGACGGAGCTAGAACGTCACGGGGCTGATATCAATGATCCACTTTGGAGTGCCAAGTGCCTTA
TTACTTCTCCTCATCTCGTCACAAAGGTGCATTTGGATTACCTCGAGTCTGGAGCAAATATCATCATTACCGCATCTTAC
CAGGCGACGATACAAGGATTTGTGGCGAAAGGTTTATCGGTAGGAGAAGCAGAAAATTTATTAAGGAGGAGCATTGAAAT
AACGTGCGAGGCACGTGAGATTTTCTACAACAGGTGCACCAAAGGTTCATGGGATTTCGCCTACGCTGGAACTGCTTCTC
GACGACCGGTTCTTGTCGCAGCTTCCGTTGGTAGCTATGGAGCTTATCTCGCCGACGGCTCCGAGTACAGCGGGATATAT
GGAGATTCTGTGAGCAAGGAGACATTGAAGGACTTCCATAGAAGAAGAGTTCAAATCTTAGCAAAATCTGGAGCTGATCT
AATAGCATTCGAGACTATTCCAAATAAGCTCGAAGCCGAGGCTTATGCTGATCTCCTTGAGGAGGAAGGTATTGAGATTC
CGGCATGGTTCTCATTCACTTCAAAAGACGGAGTCACTGTGCCACGAGGAGATTCAGTTGTCGAATGTGCGAAAGTGGCA
GATTCTTGCAAGAAAGTGGTGGCCATTGGAATCAACTGTACTGCACCAAGATACATTCATGATTTGATCATCTCCTTGCG
CCAAGTAACCCGCAAGCCAATTGTTGTCTACCCAAATAGCGGGGAAGTCTACGACGGTCTGAACAAGAAATGGATTAAGT
CAGGGGAAGAGTCAGAGGAGGATTTTGTGTCGTACGTGAGTAAATGGAGAGATGAAGGAGCGTCGCTGTTTGGAGGATGT
TGTCGGACTACTCCAAACACCATCAGAGCCATTGCTAAAGTTCTCTCCAGTGAATCTCCCGCAGCGTCAAAACTCAAACT
CAAGCAGTAG